DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Tef

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_062067.2 Gene:Tef / 29362 RGDID:3841 Length:301 Species:Rattus norvegicus


Alignment Length:295 Identity:62/295 - (21%)
Similarity:101/295 - (34%) Gaps:85/295 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 GRGGGGGAG--GALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEY-RRHLQEAASQQAA 253
            |.|.|..||  |.....|..:.....|..             :|..:|.|. :..|:|..|..|:
  Rat    17 GPGPGRAAGERGLSGSFPLVLKKLMENPP-------------RETRLDKEKGKEKLEEDESAAAS 68

  Fly   254 FMGNGAGL----------YNG------YGSGANGLTGGGNP----------------LNGGNTTP 286
            .|...|.|          |:|      |......|...|.|                |.|..:..
  Rat    69 TMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAQNLLLPVAELEGKESAS 133

  Fly   287 SSNGS--NGSTGSSNGSQFTNLTTANVLAHHNLPH---------------------LAAAAGAHN 328
            ||..|  :.||.....|:..:.|.:::......|.                     |::..|   
  Rat   134 SSTASPPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPG--- 195

  Fly   329 LLKQHSKLHAQQQHQQHQQ----QQQHRKHSNKHV-DKGTDE-YRRRRERNNIAVRKSREKAKVR 387
                 .:|...::|:..::    |...:|.....| |:..|| |..||::||:|.::||:..:::
  Rat   196 -----GELFNPRKHKFAEEDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLK 255

  Fly   388 SREVEERVKSLLKEKDALIRQLGEMTNELQLHKQI 422
            ..::..|...|.||..||..::.|:..|:...|.|
  Rat   256 ENQITIRAAFLEKENTALRTEVAELRKEVGKCKTI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 18/58 (31%)
coiled coil 363..420 CDD:269841 18/57 (32%)
TefNP_062067.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 15/65 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..174 8/43 (19%)
bZIP_HLF 230..288 CDD:269843 18/57 (32%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 233..253 8/19 (42%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 254..261 0/6 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.