DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Cebpd

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_037286.1 Gene:Cebpd / 25695 RGDID:2328 Length:268 Species:Rattus norvegicus


Alignment Length:269 Identity:71/269 - (26%)
Similarity:107/269 - (39%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 GRGGGGGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTI-----KEEPIDPEYRRHLQEAASQQ 251
            ||.|..|.|      |:|            ..:|...||.     .|..||  :..::...|:..
  Rat    28 GRVGKPGRG------PEP------------GDLGEPGSTTPAMYDDESAID--FSAYIDSMAAVP 72

  Fly   252 AAFMGNG---AGLYNGYGSGANGLTGGGNPLNGGNTTPSSNGS----------NGSTGSSNGSQF 303
            ...:.:.   |.|:|.....|.  .|....|.||.|.|...||          :...|.:.||  
  Rat    73 TLELCHDEIFADLFNSNHKAAG--AGSLELLQGGPTRPPGVGSIARGPLKREPDWGDGDAPGS-- 133

  Fly   304 TNLTTANV-LAHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHR--------------K 353
              |..|.| :....:..|||||                |.......:..|              |
  Rat   134 --LLPAQVAVCAQTVVSLAAAA----------------QPTPPTSPEPPRGSPGPSLAPGPVREK 180

  Fly   354 HSNKH-VDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQ 417
            .:.|. .|:|:.|||:|||||||||||||:|||.|::|:::::..|..|.:.|.:::.::|.:|.
  Rat   181 GAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLA 245

  Fly   418 LHKQIYMQL 426
            ..:|.:.:|
  Rat   246 SLRQFFKEL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 26/56 (46%)
CebpdNP_037286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 10/39 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..132 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..223 29/86 (34%)
bZIP_CEBPD 188..252 CDD:269862 29/63 (46%)
coiled coil 191..249 CDD:269862 26/57 (46%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 19/26 (73%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339750
Domainoid 1 1.000 57 1.000 Domainoid score I10594
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45708
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.