DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Cebpe

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_058791.1 Gene:Cebpe / 25410 RGDID:2329 Length:281 Species:Rattus norvegicus


Alignment Length:294 Identity:78/294 - (26%)
Similarity:114/294 - (38%) Gaps:85/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GGRGGGGGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEYRR----------HLQ 245
            |||.|.|..|....:......:.|..|.:|  .:.||...:|.   .||.|.          |..
  Rat    22 GGRAGPGELGDMCEHEASIDLSAYIESGEE--QLLSDLFAMKP---TPEARSLKGPGTPSFPHYL 81

  Fly   246 EAASQQAAFMGN---------GAGLYNGYGSGANGLTGGGNPLNGGNTTPSS-------NGSNGS 294
            .|..:..|:..:         |.|:|:                |.|:..|.:       .|..|:
  Rat    82 PADPRPFAYPSHTFGPDRKALGPGIYS----------------NPGSYDPRAVAVKEEPRGPEGN 130

  Fly   295 TGSSNGS----QFTNLTTANVLAHHNLPHLAA------------AAGA---HNLLKQHSKLHAQQ 340
            .|:..||    |: .:......|.|..|.|||            ||.|   ..|||..|.  |..
  Rat   131 RGTGRGSYNPLQY-QVAHCGQTAVHLPPTLAAPGQPLRVLKAPVAAAAPPCSPLLKAPSP--AGP 192

  Fly   341 QHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDAL 405
            .|:           ..|.|:|.:.|||.|||||||||||||:|||.|..|.:::|...:.|.:.|
  Rat   193 SHK-----------GKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRIMETQQKVLEYMAENERL 246

  Fly   406 IRQLGEMTNELQLHKQIYMQLMNHANPEVSRVCR 439
            ..::.::|.||...:.::.|:     ||.:.:.:
  Rat   247 RSRVDQLTQELDTLRNLFRQI-----PEAASLIK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 27/56 (48%)
CebpeNP_058791.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 5/7 (71%)
bZIP_CEBPE 202..262 CDD:269863 28/59 (47%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..245 21/36 (58%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 246..267 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339751
Domainoid 1 1.000 57 1.000 Domainoid score I10594
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45708
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.