DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Cebpa

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001274506.1 Gene:Cebpa / 24252 RGDID:2326 Length:395 Species:Rattus norvegicus


Alignment Length:361 Identity:89/361 - (24%)
Similarity:126/361 - (34%) Gaps:129/361 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ETLGIFSDMVTSPGGLSATLPPSGMVSAAAKVLQQQTLRNQH---GYGGRGGGG---------GA 199
            |.||...:..||. .:||.:.|:.........|.|.:.:.:.   ..|..||||         |.
  Rat    87 EPLGGICEHETSI-DISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGP 150

  Fly   200 GGAL----AYMPQPVH----ATYNNSSDE--NSSVGSDS---STIKEEPIDPEYRRHLQEA---- 247
            |||:    |:.|.|.:    |.|.:...|  ...||:.:   ..||:||.:.:..:.|..|    
  Rat   151 GGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP 215

  Fly   248 -------------------ASQQAAFMGNGAG-----LYNGY---------------GSGANGLT 273
                               |:....|.....|     |..|:               ..||.||.
  Rat   216 YQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLP 280

  Fly   274 GGGNPLNG--GNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSKL 336
            |.|..|.|  |.......|..|..|:..|.                                   
  Rat   281 GPGGSLKGLAGPHPDLRTGGGGGGGAGAGK----------------------------------- 310

  Fly   337 HAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKE 401
                              :.|.|||.::|||.|||||||||||||:|||.|:.|.:::|..|..:
  Rat   311 ------------------AKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSD 357

  Fly   402 KDALIRQLGEMTNELQLHKQIYMQLMNHANPEVSRV 437
            .|.|.:::.:::.||...:.|:.||     ||.|.|
  Rat   358 NDRLRKRVEQLSRELDTLRGIFRQL-----PESSLV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 27/56 (48%)
CebpaNP_001274506.1 bZIP_CEBPA 317..377 CDD:269859 28/59 (47%)
coiled coil 319..377 CDD:269859 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339748
Domainoid 1 1.000 57 1.000 Domainoid score I10594
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45708
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.