DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and atf-8

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_504576.1 Gene:atf-8 / 178998 WormBaseID:WBGene00017535 Length:241 Species:Caenorhabditis elegans


Alignment Length:281 Identity:54/281 - (19%)
Similarity:85/281 - (30%) Gaps:132/281 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 FSDMVTSPGGLSATLPPSGMVSAAAKVLQQQTLRNQHGYGGRGGGGGAGGALAYMPQPVHATY-- 214
            |..:...|..|:||...|...||....:....|.|.|              |.::......||  
 Worm    10 FKSLCAHPSTLTATFDVSPYSSAFHLPIHPALLSNTH--------------LLHLNTYNPTTYES 60

  Fly   215 --------NNSSDENSSVGS-DSSTIKEEPIDPEYRRHLQEAASQQAAFMGNGAGLYNGYGSGAN 270
                    ||:|::..|..| |||             |                           
 Worm    61 TERLFEQNNNNSEKAESCSSRDSS-------------H--------------------------- 85

  Fly   271 GLTGGGNPLNGGNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSK 335
                       .:::|:|.|     |||..         ||:..:.|                  
 Worm    86 -----------DSSSPTSTG-----GSSRD---------NVIVRNEL------------------ 107

  Fly   336 LHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLK 400
                          :.:|...|.|     .|..||.:||.|.::||::.:::..|:..|..||.:
 Worm   108 --------------KRKKDQVKDV-----AYWERRRKNNDAAKRSRDQRRMKEDEMAHRATSLER 153

  Fly   401 EKDALIR----QLGEMTNELQ 417
            | :.|:|    ||...|::|:
 Worm   154 E-NMLLRVELDQLRAETDKLR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 19/60 (32%)
coiled coil 363..420 CDD:269841 19/59 (32%)
atf-8NP_504576.1 bZIP_HLF 115..174 CDD:269843 21/65 (32%)
coiled coil 119..170 CDD:269843 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.