powered by:
Protein Alignment slbo and cebp-2
DIOPT Version :9
Sequence 1: | NP_001286836.1 |
Gene: | slbo / 37889 |
FlyBaseID: | FBgn0005638 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_871835.1 |
Gene: | cebp-2 / 172319 |
WormBaseID: | WBGene00016754 |
Length: | 100 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 21/73 - (28%) |
Similarity: | 45/73 - (61%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 352 RKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNEL 416
::::::..:...|:|..:|:|||.||.::|:|.:....:..|:|..|.||.:.|.|::.::..||
Worm 6 KRNTSEPREDDEDDYSTKRKRNNEAVNRTRQKKRQEENDTAEKVDELKKENETLERKVEQLQKEL 70
Fly 417 QLHKQIYM 424
...|:::|
Worm 71 SFLKEMFM 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3119 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002856 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4506 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
5 | 4.800 |
|
Return to query results.
Submit another query.