DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and cebp-2

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_871835.1 Gene:cebp-2 / 172319 WormBaseID:WBGene00016754 Length:100 Species:Caenorhabditis elegans


Alignment Length:73 Identity:21/73 - (28%)
Similarity:45/73 - (61%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 RKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNEL 416
            ::::::..:...|:|..:|:|||.||.::|:|.:....:..|:|..|.||.:.|.|::.::..||
 Worm     6 KRNTSEPREDDEDDYSTKRKRNNEAVNRTRQKKRQEENDTAEKVDELKKENETLERKVEQLQKEL 70

  Fly   417 QLHKQIYM 424
            ...|:::|
 Worm    71 SFLKEMFM 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 19/57 (33%)
coiled coil 363..420 CDD:269841 19/56 (34%)
cebp-2NP_871835.1 bZIP_CEBP 16..75 CDD:269841 19/58 (33%)
coiled coil 20..71 CDD:269841 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002856
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.