DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and zip-4

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001368002.1 Gene:zip-4 / 171900 WormBaseID:WBGene00021552 Length:318 Species:Caenorhabditis elegans


Alignment Length:72 Identity:26/72 - (36%)
Similarity:39/72 - (54%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 RKHSNKHVDKGTDE--YRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTN 414
            ||: |...||...|  |:.:|.|||.||||||.|||....:.:|       |.|.:.:::.::..
 Worm   216 RKY-NLKPDKEKVEPIYKLKRARNNDAVRKSRNKAKELQLQKDE-------EYDEMKKRITQLEA 272

  Fly   415 ELQLHKQ 421
            |||..::
 Worm   273 ELQSERE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 21/59 (36%)
coiled coil 363..420 CDD:269841 21/58 (36%)
zip-4NP_001368002.1 bZIP 231..294 CDD:419672 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.