powered by:
Protein Alignment slbo and zip-4
DIOPT Version :9
Sequence 1: | NP_001286836.1 |
Gene: | slbo / 37889 |
FlyBaseID: | FBgn0005638 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001368002.1 |
Gene: | zip-4 / 171900 |
WormBaseID: | WBGene00021552 |
Length: | 318 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 26/72 - (36%) |
Similarity: | 39/72 - (54%) |
Gaps: | 10/72 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 352 RKHSNKHVDKGTDE--YRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTN 414
||: |...||...| |:.:|.|||.||||||.|||....:.:| |.|.:.:::.::..
Worm 216 RKY-NLKPDKEKVEPIYKLKRARNNDAVRKSRNKAKELQLQKDE-------EYDEMKKRITQLEA 272
Fly 415 ELQLHKQ 421
|||..::
Worm 273 ELQSERE 279
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160166960 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.