DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and DDIT3

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001181982.1 Gene:DDIT3 / 1649 HGNCID:2726 Length:192 Species:Homo sapiens


Alignment Length:149 Identity:31/149 - (20%)
Similarity:65/149 - (43%) Gaps:23/149 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 SSNGSNGSTGSSNGSQ------FTNLTTANV--LAHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQ 343
            ||:.:.|:..|..|::      ||.|..|::  |.... |..|.......  ..||...:|....
Human    53 SSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEE-PEPAEVTSTSQ--SPHSPDSSQSSLA 114

  Fly   344 QHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQ 408
            |.::::          |:|  ..|:|::..:...|..:::.|.:.:|.|.:|..|.:|.:.|.::
Human   115 QEEEEE----------DQG--RTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQE 167

  Fly   409 LGEMTNELQLHKQIYMQLM 427
            :..:|.|::..::..:..|
Human   168 IERLTREVEATRRALIDRM 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 13/57 (23%)
coiled coil 363..420 CDD:269841 12/56 (21%)
DDIT3NP_001181982.1 BRLZ 119..182 CDD:197664 14/74 (19%)
coiled coil 122..176 CDD:269834 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.