DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and DBP

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001343.2 Gene:DBP / 1628 HGNCID:2697 Length:325 Species:Homo sapiens


Alignment Length:310 Identity:52/310 - (16%)
Similarity:94/310 - (30%) Gaps:118/310 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GGRGGGGGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFM 255
            ||..|....||||..:...:..|                :..:||.....:...::||...|...
Human    16 GGPAGTPPGGGALLGLRSLLQGT----------------SKPKEPASCLLKEKERKAALPAATTP 64

  Fly   256 GNGAGLYNGYGSGANGLTGGGNPLN---------------------------------------- 280
            |.|........:.|..:.|||:|..                                        
Human    65 GPGLETAGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLDAFLLEHGLP 129

  Fly   281 ------GGNT-------TPSSNGSNGSTGSSN-----------------GSQFTNLTTANV---- 311
                  ||.:       ||:.:...||.||::                 ......||:.:.    
Human   130 PSPPPPGGPSPEPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASGHRAGLTSRDTPSPV 194

  Fly   312 -----------------LAHHNLP-HLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKH 358
                             ||..::| |.......|...::..|.....:..:..|..:.:|     
Human   195 DPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQK----- 254

  Fly   359 VDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQ 408
                .::|..||.:||.|.::||:..:::..::..|. :.|::::||:||
Human   255 ----DEKYWSRRYKNNEAAKRSRDARRLKENQISVRA-AFLEKENALLRQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 14/47 (30%)
coiled coil 363..420 CDD:269841 14/46 (30%)
DBPNP_001343.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99 20/98 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..200 10/72 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..255 3/34 (9%)
bZIP_HLF 254..313 CDD:269843 15/56 (27%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 257..279 8/21 (38%)
coiled coil 258..309 CDD:269843 14/43 (33%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..297 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.