Sequence 1: | NP_001286836.1 | Gene: | slbo / 37889 | FlyBaseID: | FBgn0005638 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343.2 | Gene: | DBP / 1628 | HGNCID: | 2697 | Length: | 325 | Species: | Homo sapiens |
Alignment Length: | 310 | Identity: | 52/310 - (16%) |
---|---|---|---|
Similarity: | 94/310 - (30%) | Gaps: | 118/310 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 GGRGGGGGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFM 255
Fly 256 GNGAGLYNGYGSGANGLTGGGNPLN---------------------------------------- 280
Fly 281 ------GGNT-------TPSSNGSNGSTGSSN-----------------GSQFTNLTTANV---- 311
Fly 312 -----------------LAHHNLP-HLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKH 358
Fly 359 VDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQ 408 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slbo | NP_001286836.1 | bZIP_CEBP | 362..420 | CDD:269841 | 14/47 (30%) |
coiled coil | 363..420 | CDD:269841 | 14/46 (30%) | ||
DBP | NP_001343.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..99 | 20/98 (20%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 127..200 | 10/72 (14%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 229..255 | 3/34 (9%) | |||
bZIP_HLF | 254..313 | CDD:269843 | 15/56 (27%) | ||
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 257..279 | 8/21 (38%) | |||
coiled coil | 258..309 | CDD:269843 | 14/43 (33%) | ||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 283..297 | 3/14 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |