DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and cebpg

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_571961.1 Gene:cebpg / 140816 ZFINID:ZDB-GENE-020111-5 Length:163 Species:Danio rerio


Alignment Length:154 Identity:44/154 - (28%)
Similarity:74/154 - (48%) Gaps:23/154 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 SSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAA-AGAHNLLKQHSKLHAQQQHQQHQQQQQ 350
            ||...||.:...|....:.|..|.......:|.|... .|........||:              
Zfish    10 SSTDQNGVSVIQNQPHNSALNPAGAAGLQQVPQLVPVNPGGGGKATAPSKM-------------- 60

  Fly   351 HRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNE 415
              |.||  :||.:||||:||||||:||:|||.::|.::::.::||..|.:|.:.|..::..::.|
Zfish    61 --KKSN--MDKDSDEYRQRRERNNLAVKKSRMRSKQKAQDTQQRVNELKEENERLEAKIKLLSKE 121

  Fly   416 LQLHKQIYMQ----LMNHANPEVS 435
            |.:.|.::::    |.::..|..|
Zfish   122 LSVLKDLFLEHAHNLADNVQPPAS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 23/57 (40%)
coiled coil 363..420 CDD:269841 23/56 (41%)
cebpgNP_571961.1 bZIP_CEBPG 67..127 CDD:269861 24/59 (41%)
coiled coil 69..127 CDD:269861 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10541
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002856
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.