DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and cebpa

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_571960.1 Gene:cebpa / 140815 ZFINID:ZDB-GENE-020111-2 Length:288 Species:Danio rerio


Alignment Length:365 Identity:90/365 - (24%)
Similarity:128/365 - (35%) Gaps:129/365 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 MQQVAALGSNNNLLQKQMLQQY---STQTDLDELTTQEITLDLQHLID-DQFRDTETLGIFSDMV 156
            :.:||......:|:|.|. ..|   .|..||.|:...|.::|:...|| ..|.|.....:|.:. 
Zfish     6 LYEVAPRPLMTSLVQNQQ-NPYIYKDTAGDLSEICENENSIDISAYIDPSAFNDEFLADLFHNS- 68

  Fly   157 TSPGGLSATLPPSGMVSAAAKVLQQQTLRNQHG-YGGRGGGGGAGGALAYMPQPVHATYNNSSDE 220
                                  .:|:.|:...| |....|..||.||    || ::...|...|.
Zfish    69 ----------------------SKQEKLKLASGDYDYHHGANGAPGA----PQ-MYGCLNGYMDS 106

  Fly   221 NSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFMGNGAGLYNGYGSGANGLTGGGNPLN----G 281
            :          |.|||.....|....|..|:                          |..    |
Zfish   107 S----------KLEPIYDSQARMRPVAIKQE--------------------------PREEDELG 135

  Fly   282 GNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSKLHAQQ------ 340
            .:..|:.:.|                      .|:.|||:        ..||...|..|      
Zfish   136 DSMPPTYHHS----------------------QHHAPHLS--------YLQHQIAHCAQTTMHLQ 170

  Fly   341 -------------QHQQH------QQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKV 386
                         .|.||      ..:...|..|.|||||.:.|||.|||||||||||||:|||:
Zfish   171 PGHPTPPPTPVPSPHHQHSHLPGGSMKIGDRGKSKKHVDKNSTEYRLRRERNNIAVRKSRDKAKM 235

  Fly   387 RSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQL 426
            |:.|.:::|..|..:.|.|.:::..:|.||:..:.|:.||
Zfish   236 RNVETQQKVIELSADNDRLRKRVEHLTRELETLRGIFRQL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 28/57 (49%)
coiled coil 363..420 CDD:269841 28/56 (50%)
cebpaNP_571960.1 bZIP_CEBPA 210..270 CDD:269859 29/59 (49%)
coiled coil 212..270 CDD:269859 28/57 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579541
Domainoid 1 1.000 60 1.000 Domainoid score I10541
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto39998
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.