DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Cebpd

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_031705.3 Gene:Cebpd / 12609 MGIID:103573 Length:268 Species:Mus musculus


Alignment Length:194 Identity:58/194 - (29%)
Similarity:86/194 - (44%) Gaps:48/194 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 AGLYNGYGSGANGLTGGGNPLNGGNTTPSSNGS----------NGSTGSSNGSQFTNLTTANV-L 312
            |.|:|.....|.  .||...|.||.|.|...||          :...|.:.||    |..|.| :
Mouse    83 ADLFNSNHKAAG--AGGLELLQGGPTRPPGVGSVARGPLKREPDWGDGDAPGS----LLPAQVAV 141

  Fly   313 AHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHR--------------KHSNKH-VDKG 362
            ....:..|||||                |.......:..|              |.:.|. .|:|
Mouse   142 CAQTVVSLAAAA----------------QPTPPTSPEPPRGSPGPSLAPGTVREKGAGKRGPDRG 190

  Fly   363 TDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQL 426
            :.|||:|||||||||||||:|||.|::|:::::..|..|.:.|.:::.::|.:|...:|.:.:|
Mouse   191 SPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKKL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 26/56 (46%)
CebpdNP_031705.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..132 9/34 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..219 28/82 (34%)
bZIP_CEBPD 188..252 CDD:269862 29/63 (46%)
coiled coil 191..249 CDD:269862 26/57 (46%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 19/26 (73%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836086
Domainoid 1 1.000 57 1.000 Domainoid score I10807
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.