DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Cebpa

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001274443.1 Gene:Cebpa / 12606 MGIID:99480 Length:396 Species:Mus musculus


Alignment Length:370 Identity:90/370 - (24%)
Similarity:126/370 - (34%) Gaps:146/370 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ETLGIFSDMVTSPGGLSATLPPSGMVSAAAKVLQQQTLRNQH---GYGGRGGGG---------GA 199
            |.||...:..||. .:||.:.|:.........|.|.:.:.:.   ..|..||||         |.
Mouse    87 EPLGGICEHETSI-DISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGP 150

  Fly   200 GGAL----AYMPQPVH----ATYNNSSDE--NSSVGSDS---STIKEEPIDPEYRR--------- 242
            |||:    |:.|.|.:    |.|.:...|  ...||:.:   ..||:||.:.:..:         
Mouse   151 GGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP 215

  Fly   243 ------------------------------------HLQ---------EAASQQAAFMGNGAGLY 262
                                                |||         ...|..||.....||| 
Mouse   216 YQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHAAPALGAAGL- 279

  Fly   263 NGYGSGANGLTGGGNPLNGGNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAH 327
            .|.||...||.|....|..|       |..|.:|:..|.                          
Mouse   280 PGPGSALKGLAGAHPDLRTG-------GGGGGSGAGAGK-------------------------- 311

  Fly   328 NLLKQHSKLHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVE 392
                                       :.|.|||.::|||.|||||||||||||:|||.|:.|.:
Mouse   312 ---------------------------AKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQ 349

  Fly   393 ERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQLMNHANPEVSRV 437
            ::|..|..:.|.|.:::.:::.||...:.|:.||     ||.|.|
Mouse   350 QKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQL-----PESSLV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 27/56 (48%)
CebpaNP_001274443.1 bZIP_CEBPA 318..378 CDD:269859 28/59 (47%)
coiled coil 320..378 CDD:269859 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836084
Domainoid 1 1.000 57 1.000 Domainoid score I10807
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.