DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Nfil3

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_446179.2 Gene:Nfil3 / 114519 RGDID:620972 Length:462 Species:Rattus norvegicus


Alignment Length:179 Identity:41/179 - (22%)
Similarity:70/179 - (39%) Gaps:40/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 TGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKHV 359
            ||||:.....|...|.|...       .|:|...||.:.|.       .:::.....||......
  Rat    19 TGSSDKMLLLNSALAEVAED-------LASGEDLLLNEGSM-------GKNKSSACRRKREFIPD 69

  Fly   360 DKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSL-------------LKEKDALI----- 406
            :|....|..:|.:||.|.::||||.::....:|.::.:|             ||.|..||     
  Rat    70 EKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTVY 134

  Fly   407 -RQLGEMTNELQLHKQIYMQLMNHA------NPEVSRVCRSFLNTNEHS 448
             :::.:::|...::.|.| |....|      ..|.:.|..|.::..:||
  Rat   135 AQEIQKLSNSTAVYFQDY-QTSKAAVSSYVDEHEPAMVAGSCISVIKHS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 17/76 (22%)
coiled coil 363..420 CDD:269841 17/75 (23%)
Nfil3NP_446179.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 2/2 (100%)
bZIP_NFIL3 72..131 CDD:269842 16/58 (28%)
coiled coil 76..127 CDD:269842 14/50 (28%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..95 8/15 (53%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 99..106 1/6 (17%)
Vert_IL3-reg_TF 130..461 CDD:368956 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.