DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Cebpe

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_997014.1 Gene:Cebpe / 110794 MGIID:103572 Length:281 Species:Mus musculus


Alignment Length:290 Identity:82/290 - (28%)
Similarity:114/290 - (39%) Gaps:77/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GGRGGGGGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFM 255
            |||.|.|..|....:......:.|..|.:|  .:.||...:|..|          ||.|    ..
Mouse    22 GGRAGPGELGDMCEHEASIDLSAYIESGEE--QLLSDLFAMKPTP----------EARS----LK 70

  Fly   256 GNGAGLYNGY---------------GSGANGLTGGGNPLNGGNTTPSS-------NGSNGSTGSS 298
            |.||..:..|               |.....| |.|...|.|:..|.:       .|..|:.|:|
Mouse    71 GPGAPSFPHYLPADPRPFAYPSHTFGPDRKAL-GPGIYSNPGSYDPRAVAVKEEPRGPEGNRGTS 134

  Fly   299 NGS----QFTNLTTANVLAHHNLPHLAA------------AAGA---HNLLKQHSKLHAQQQHQQ 344
            .||    |: .:......|.|..|.|||            ||.|   ..|||..|.  |...|: 
Mouse   135 RGSYNPLQY-QVAHCGQTAVHLPPTLAAPGQPLRVLKAPVAAAAPPCSPLLKAPSP--AGPSHK- 195

  Fly   345 HQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQL 409
                      ..|.|:|.:.|||.|||||||||||||:|||.|..|.:::|...:.|.:.|..::
Mouse   196 ----------GKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRIMETQQKVLEYMAENERLRNRV 250

  Fly   410 GEMTNELQLHKQIYMQLMNHANPEVSRVCR 439
            .::|.||...:.::.|:     ||.:.:.:
Mouse   251 DQLTQELDTLRNLFRQI-----PEAASLIK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 27/56 (48%)
CebpeNP_997014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 5/7 (71%)
bZIP_CEBPE 202..262 CDD:269863 28/59 (47%)
coiled coil 204..262 CDD:269863 27/57 (47%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..245 21/36 (58%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 246..267 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836087
Domainoid 1 1.000 57 1.000 Domainoid score I10807
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.