DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and CEBPG

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001239225.1 Gene:CEBPG / 1054 HGNCID:1837 Length:150 Species:Homo sapiens


Alignment Length:121 Identity:38/121 - (31%)
Similarity:67/121 - (55%) Gaps:19/121 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 GAHNLLKQHSKLHAQQQHQQHQ--------------QQQQHRKHSNKHVDKGTDEYRRRRERNNI 375
            |.:.:...|::.||....|..|              ..:|.:|.|  .:|:.:||||:||||||:
Human    12 GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSS--PMDRNSDEYRQRRERNNM 74

  Fly   376 AVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQLMNHAN 431
            ||:|||.|:|.::::..:||..|.:|.:.|..::..:|.||.:.|.::::   ||:
Human    75 AVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLE---HAH 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 25/57 (44%)
coiled coil 363..420 CDD:269841 25/56 (45%)
CEBPGNP_001239225.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..94 23/68 (34%)
bZIP_CEBPG 60..120 CDD:269861 25/59 (42%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 66..93 14/26 (54%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 97..118 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10990
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002856
OrthoInspector 1 1.000 - - otm41584
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.