DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and CEBPE

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001796.2 Gene:CEBPE / 1053 HGNCID:1836 Length:281 Species:Homo sapiens


Alignment Length:285 Identity:75/285 - (26%)
Similarity:104/285 - (36%) Gaps:78/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GGRGGGGGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFM 255
            |||.|.|..|....:......:.|..|.:|  .:.||...:|..|              :.....
Human    22 GGRAGPGELGDMCEHEASIDLSAYIESGEE--QLLSDLFAVKPAP--------------EARGLK 70

  Fly   256 GNGAGLYNGY---------------GSGANGLTGGGNPLNGGNTTPSS-------NGSNGSTGSS 298
            |.|...:..|               |.....| |.|...:.|:..|.:       .|..||..:|
Human    71 GPGTPAFPHYLPPDPRPFAYPPHTFGPDRKAL-GPGIYSSPGSYDPRAVAVKEEPRGPEGSRAAS 134

  Fly   299 NGS----QFTNLTTANVLAHHNLPHLA---------------AAAGAHNLLKQHS---KLHAQQQ 341
            .||    |: .:......|.|..|.||               ||.....|||..|   .||    
Human   135 RGSYNPLQY-QVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLH---- 194

  Fly   342 HQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALI 406
                        ...|.|:|.:.|||.|||||||||||||:|||.|..|.:::|...:.|.:.|.
Human   195 ------------KGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLR 247

  Fly   407 RQLGEMTNELQLHKQIYMQLMNHAN 431
            .::.::|.||...:.::.|:...||
Human   248 SRVEQLTQELDTLRNLFRQIPEAAN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 27/56 (48%)
CEBPENP_001796.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 5/7 (71%)
PHA03247 <62..192 CDD:223021 28/145 (19%)
bZIP_CEBPE 202..262 CDD:269863 28/59 (47%)
coiled coil 207..258 CDD:269863 25/50 (50%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..228 17/19 (89%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 230..237 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146012
Domainoid 1 1.000 56 1.000 Domainoid score I10990
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5346
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41584
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.