DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and CEBPD

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_005186.2 Gene:CEBPD / 1052 HGNCID:1835 Length:269 Species:Homo sapiens


Alignment Length:254 Identity:66/254 - (25%)
Similarity:106/254 - (41%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 GYGGRGGGGGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAA 253
            |..|:.|.|...|||........|.|    |:.|::              ::..::...|:....
Human    28 GRAGKPGRGAEPGALGEPGAAAPAMY----DDESAI--------------DFSAYIDSMAAVPTL 74

  Fly   254 FMGNG---AGLYNGYGSGANGLTGGGNPLN---GGNTTPSSNG----------SNGSTGSSNGSQ 302
            .:.:.   |.|:|     :|...||..||.   ||...|...|          .:...|.:.|| 
Human    75 ELCHDELFADLFN-----SNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGS- 133

  Fly   303 FTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYR 367
               |..|.|.|........||||............:..:........:.:....:..|:|:.|||
Human   134 ---LLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYR 195

  Fly   368 RRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQL 426
            :|||||||||||||:|||.|::|:::::..|..|.:.|.:::.::|.:|...:|.:.||
Human   196 QRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 26/56 (46%)
CEBPDNP_005186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..133 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..219 25/67 (37%)
bZIP_CEBPD 188..252 CDD:269862 29/63 (46%)
coiled coil 191..249 CDD:269862 26/57 (46%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 19/26 (73%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146011
Domainoid 1 1.000 56 1.000 Domainoid score I10990
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5346
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41584
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.