DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and CEBPA

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001274353.1 Gene:CEBPA / 1050 HGNCID:1833 Length:393 Species:Homo sapiens


Alignment Length:326 Identity:84/326 - (25%)
Similarity:117/326 - (35%) Gaps:129/326 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 QQQTLRNQHGYGGRGGGG---------GAGGAL----AYMPQPVH----ATYNNSSDE--NSSVG 225
            ||:..:...|..|.||||         |.|||:    |:.|.|.:    |.|.:...|  ...||
Human   122 QQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVG 186

  Fly   226 SDS---STIKEEPIDPEYRRHLQEA-------------------------ASQQAAFMGNGAG-- 260
            :.:   ..||:||.:.:..:.|..|                         |:....|.....|  
Human   187 APALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQT 251

  Fly   261 ---LYNGYGS---------------GANGLTGGGNPLNG-GNTTPSSNGSNGSTGSSNGSQFTNL 306
               |..|:.:               ||.||.|.|:.|.| |...|....|.||            
Human   252 TMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGS------------ 304

  Fly   307 TTANVLAHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRE 371
                            .||                            .:.|.|||.::|||.|||
Human   305 ----------------GAG----------------------------KAKKSVDKNSNEYRVRRE 325

  Fly   372 RNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQLMNHANPEVSR 436
            ||||||||||:|||.|:.|.:::|..|..:.|.|.:::.:::.||...:.|:.||     ||.|.
Human   326 RNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQL-----PESSL 385

  Fly   437 V 437
            |
Human   386 V 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 27/56 (48%)
CEBPANP_001274353.1 bZIP_CEBPA 315..375 CDD:269859 28/59 (47%)
coiled coil 317..375 CDD:269859 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146009
Domainoid 1 1.000 56 1.000 Domainoid score I10990
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5346
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41584
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.