DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and thibz

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_017948046.1 Gene:thibz / 100485028 XenbaseID:XB-GENE-484679 Length:335 Species:Xenopus tropicalis


Alignment Length:96 Identity:27/96 - (28%)
Similarity:42/96 - (43%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 PHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQ----HRKHSNKHVDKGTDEYRRRRERNNIAVR 378
            |..:..:|: .||...|.|..:..|........    .|:......:|..|.|..:|.:||.|.:
 Frog    40 PSTSLISGS-GLLLARSLLGCRNSHSSPTSCSSPCNIRRRREFTPDEKKDDCYWDKRRKNNEAAK 103

  Fly   379 KSREKAKVRSREVEERVKSLLKEKDALIRQL 409
            :||||.:.....:|.||.:||:|...|..:|
 Frog   104 RSREKRRAGDLALEGRVIALLEENARLRAEL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 18/48 (38%)
coiled coil 363..420 CDD:269841 18/47 (38%)
thibzXP_017948046.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.