DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and cebpe

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_031746961.1 Gene:cebpe / 100038238 XenbaseID:XB-GENE-853430 Length:253 Species:Xenopus tropicalis


Alignment Length:276 Identity:68/276 - (24%)
Similarity:102/276 - (36%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 GYGGRGGGGGA---GGALAYMPQPVH-ATYNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAAS 249
            ||..|..|..:   ||.|......|. ::|..:.:|   :.||...:|:|.:...|.....|...
 Frog    17 GYTARLSGPQSELMGGNLCDPETSVDLSSYIETGEE---MLSDLFPLKQERLKGTYPYIPPEGLP 78

  Fly   250 QQAAFMGNGAGLYNGYGSGANGLTGGGNPLNGGNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAH 314
                    .|.||....|..:....||....|......:.|::  .|..|..|:.....|....|
 Frog    79 --------SAALYGYAPSNTSERRMGGYESGGVIVKEETRGTH--RGVCNTLQYQAAQCAQTAMH 133

  Fly   315 HNLPHLAAAAGAH---------------------NLLKQHSKLHAQQQHQQHQQQQQHRKHSNKH 358
              ||  :...|.|                     |.||                       ..|.
 Frog   134 --LP--SPLEGVHPALRVLKGSISGMLSGPPLKDNALK-----------------------GKKC 171

  Fly   359 VDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIY 423
            :.|.:.|||.|||||||||||||:|||.|:.|.::|....:.|.:.|..::.::|.||...:.::
 Frog   172 LSKDSLEYRLRRERNNIAVRKSRDKAKRRNLETQQRALEYMAENEKLRNRIQQLTQELDALRGVF 236

  Fly   424 MQLMNHANPEVSRVCR 439
            .|:     ||.:.:.:
 Frog   237 RQI-----PEAAALSK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 27/57 (47%)
coiled coil 363..420 CDD:269841 27/56 (48%)
cebpeXP_031746961.1 bZIP_CEBPE 174..234 CDD:269863 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10676
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.