DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and nfil3-4

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001183995.1 Gene:nfil3-4 / 100000898 ZFINID:ZDB-GENE-070424-214 Length:261 Species:Danio rerio


Alignment Length:79 Identity:23/79 - (29%)
Similarity:35/79 - (44%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 QQHQQHQQQQQ---------HRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERV 395
            |....|:.:.:         .||......||....|..:|.:||.|.::||||.:|....:|.|:
Zfish     7 QMRWDHEGESEEMSLRALGLRRKREFIPEDKKDAMYWEKRRKNNEAAKRSREKRRVSDYMLETRL 71

  Fly   396 KSLLKEKDALIRQL 409
            .||.:|...|..:|
Zfish    72 VSLSEENARLRAEL 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 17/48 (35%)
coiled coil 363..420 CDD:269841 17/47 (36%)
nfil3-4NP_001183995.1 bZIP 38..>78 CDD:304365 14/39 (36%)
Vert_IL3-reg_TF <215..>255 CDD:284047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.