| Sequence 1: | NP_940988.2 | Gene: | NHLRC1 / 378884 | HGNCID: | 21576 | Length: | 395 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009304581.1 | Gene: | trim2b / 558046 | ZFINID: | ZDB-GENE-090312-70 | Length: | 669 | Species: | Danio rerio |
| Alignment Length: | 223 | Identity: | 53/223 - (23%) |
|---|---|---|---|
| Similarity: | 87/223 - (39%) | Gaps: | 67/223 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Human 122 GWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDC 186
Human 187 HVVVTDAGDRSIKVFDFFGQIKLVIG------GQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVD 245
Human 246 FAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLEHPLALGTGVCSTRVKVFSSSMQLVGQVDTF 310
Human 311 GLSLYFPSKITASAVTFDHQGNVIVADT 338 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| NHLRC1 | NP_940988.2 | RING-HC_malin | 25..72 | CDD:319430 | |
| RING-HC finger (C3HC4-type) | 26..71 | CDD:319430 | |||
| HemN | 53..>133 | CDD:333012 | 5/10 (50%) | ||
| NHL 1 | 113..157 | 12/34 (35%) | |||
| NHL_TRIM32_like | 118..391 | CDD:271331 | 53/223 (24%) | ||
| NHL repeat | 129..169 | CDD:271331 | 12/39 (31%) | ||
| NHL 2 | 161..204 | 11/42 (26%) | |||
| NHL repeat | 177..216 | CDD:271331 | 13/44 (30%) | ||
| NHL 3 | 205..245 | 12/45 (27%) | |||
| NHL repeat | 218..259 | CDD:271331 | 6/40 (15%) | ||
| NHL 4 | 248..300 | 4/51 (8%) | |||
| NHL repeat | 261..313 | CDD:271331 | 6/51 (12%) | ||
| NHL 5 | 301..349 | 12/38 (32%) | |||
| NHL repeat | 321..353 | CDD:271331 | 8/18 (44%) | ||
| NHL 6 | 350..393 | ||||
| NHL repeat | 364..390 | CDD:271331 | |||
| trim2b | XP_009304581.1 | zf-B_box | 29..66 | CDD:279037 | |
| iSH2_PI3K_IA_R | 73..199 | CDD:304922 | |||
| IG_FLMN | 237..334 | CDD:214720 | |||
| Filamin | 237..329 | CDD:279024 | |||
| NHL_TRIM2_like | 396..669 | CDD:271330 | 53/223 (24%) | ||
| NHL repeat | 414..453 | CDD:271330 | |||
| YncE | 415..>660 | CDD:225926 | 53/223 (24%) | ||
| NHL repeat | 461..500 | CDD:271330 | 2/3 (67%) | ||
| NHL repeat | 503..540 | CDD:271330 | 12/37 (32%) | ||
| NHL repeat | 547..588 | CDD:271330 | 11/40 (28%) | ||
| NHL repeat | 594..636 | CDD:271330 | 13/96 (14%) | ||
| NHL repeat | 639..665 | CDD:271330 | 10/24 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| NCBI | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||