DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub60D and TUBD1

DIOPT Version :9

Sequence 1:NP_523842.2 Gene:betaTub60D / 37888 FlyBaseID:FBgn0003888 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_057345.2 Gene:TUBD1 / 51174 HGNCID:16811 Length:453 Species:Homo sapiens


Alignment Length:493 Identity:117/493 - (23%)
Similarity:211/493 - (42%) Gaps:113/493 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVNLQAGQCGNQIGAKFWE-IISEEHGIDSNGIYVGDSDLQLERVSVYYNEASAV-------TRS 60
            ||.:|.||||||||.:.:: ::|:.|  .|.|:           .|:..|||...       :..
Human     3 IVTVQLGQCGNQIGFEVFDALLSDSH--SSQGL-----------CSMRENEAYQASCKERFFSEE 54

  Fly    61 SGGKYVPRAILLDLEPGTMESV--RSGPYGQLFRPDNFVYGQ-------SGAGNNWAKGHYTEGA 116
            ..|..:.||:|:|:||..:..:  ::...||      :.|||       .|:|||||.|:...|.
Human    55 ENGVPIARAVLVDMEPKVINQMLSKAAQSGQ------WKYGQHACFCQKQGSGNNWAYGYSVHGP 113

  Fly   117 ELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKV 181
            ...:::::::|||.|.||...||.:..|:.||||||:|..:...:.::|.:.:.....:.|. ..
Human   114 RHEESIMNIIRKEVEKCDSFSGFFIIMSMAGGTGSGLGAFVTQNLEDQYSNSLKMNQIIWPY-GT 177

  Fly   182 SDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCL 246
            .:.:|:.||:.|::..|..::|.....:|:|::.||.:.:.:...|:.|:|.:::..:..|    
Human   178 GEVIVQNYNSILTLSHLYRSSDALLLHENDAIHKICAKLMNIKQISFSDINQVLAHQLGSV---- 238

  Fly   247 RFPGQLNAD---------LRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALT----VPELTQQ 298
             |....:|:         |..|..::||.|..........|..|..|..|...|    :..|.|.
Human   239 -FQPTYSAESSFHYRRNPLGDLMEHLVPHPEFKMLSVRNIPHMSENSLAYTTFTWAGLLKHLRQM 302

  Fly   299 MFDAKNMMAACDPRH----------------------GRYLTVAAVFRGRMSMKEVDEQMLAVQN 341
            :.....|....| ||                      ...:....:.||:      |.|...|:.
Human   303 LISNAKMEEGID-RHVWPPLSGLPPLSKMSLNKDLHFNTSIANLVILRGK------DVQSADVEG 360

  Fly   342 -KNSSYFVEWI-PNNV--------------KTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQ 390
             |:.:.:..|: |.|.              |:||       |..:|.|:     ::.|...:.:.
Human   361 FKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAV-------LVSNSQFL-----VKPLDMIVGKA 413

  Fly   391 FSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEY 428
            :: ||..||::|.||..|::|.:|.::.:::..:|:.|
Human   414 WN-MFASKAYIHQYTKFGIEEEDFLDSFTSLEQVVASY 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub60DNP_523842.2 PLN00220 1..450 CDD:215107 117/493 (24%)
beta_tubulin 2..432 CDD:276956 117/493 (24%)
TUBD1NP_057345.2 delta_zeta_tubulin-like 2..452 CDD:276958 117/493 (24%)
Tubulin 2..213 CDD:278518 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.