DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub60D and tubd1

DIOPT Version :9

Sequence 1:NP_523842.2 Gene:betaTub60D / 37888 FlyBaseID:FBgn0003888 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001002093.1 Gene:tubd1 / 415183 ZFINID:ZDB-GENE-040625-73 Length:446 Species:Danio rerio


Alignment Length:465 Identity:124/465 - (26%)
Similarity:216/465 - (46%) Gaps:64/465 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVNLQAGQCGNQIGAKFWEIISEEHGIDSNG----IYVGDSDLQLERVSVYYNEASAVTRSSGGK 64
            :|:||.||||||||.:.:.:||:    ||||    .|...||   ||  .:|       ::|.|:
Zfish     3 VVSLQLGQCGNQIGHELFSVISD----DSNGPNRKKYKQCSD---ER--FFY-------QNSAGE 51

  Fly    65 YVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYG-------QSGAGNNWAKGHYTEGAELVDNV 122
            .|.|::|:|:||    .|.|....:..:...:.||       :.|:|||||.|....|....::|
Zfish    52 LVARSVLVDMEP----KVISQALAKASKSGRWRYGDKAHFSQKQGSGNNWANGFCVHGPRHKEDV 112

  Fly   123 LDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR-IMNTYSVVPSPKVSDTVV 186
            .|:||.|.|.||.|.|.....|:.||||||:||.:..::|:.||.. |:|  .|.......:.:|
Zfish   113 EDLVRMEVERCDRLAGIFTMMSVAGGTGSGVGTYITQRLRDLYPQSFILN--QVTWPYGAGEVIV 175

  Fly   187 EPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGV---TTCLRF 248
            :.||:.|::..|.:.:|.....:|:.::.||.:.:.:.:.|..|:|.::|..::.|   ......
Zfish   176 QNYNSVLTLSHLYQLSDAILVHENDTVHKICSQLMNIKHISISDINKVISHQLASVLQPVYTAHS 240

  Fly   249 PGQLNAD-LRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPR 312
            |...:.: :.:|..::|..|..........|..|..|..|.....|.|.:.:  .:.::|:....
Zfish   241 PDYYSRNPIGELLTSLVCHPEYKLLSLCNIPQMSSTSLAYSVFNWPGLLKHL--RQMLIASARME 303

  Fly   313 HGRYLTV---AAVFRGRMSMKEVDEQ--------MLAVQNKNSS-----------YFVEWI--PN 353
            .|...||   :.|..|..|:..:..:        :|.::.|:.|           .:|.|:  .|
Zfish   304 EGIDWTVNVPSVVLSGAESVTNIRHKSFNSSLANLLILRGKDVSTAVTDGFKDPLLYVPWLKAEN 368

  Fly   354 NVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAE 418
            :..|....||..|.:.|:|.:.|:.::.:....|..:...||..:|::|.||..|:.|.:|.::.
Zfish   369 SFSTWSSPIPFNGYEKSATLVSNSQSLLKPLDNIVRKAWNMFASRAYIHQYTKFGISEEDFLDSF 433

  Fly   419 SNMNDLVSEY 428
            :.:..::|.|
Zfish   434 TALEQIISSY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub60DNP_523842.2 PLN00220 1..450 CDD:215107 124/465 (27%)
beta_tubulin 2..432 CDD:276956 124/465 (27%)
tubd1NP_001002093.1 delta_zeta_tubulin-like 2..445 CDD:276958 124/465 (27%)
COG5023 3..443 CDD:227356 123/463 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.