DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub60D and Tubal3

DIOPT Version :9

Sequence 1:NP_523842.2 Gene:betaTub60D / 37888 FlyBaseID:FBgn0003888 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001099588.1 Gene:Tubal3 / 291287 RGDID:1305289 Length:382 Species:Rattus norvegicus


Alignment Length:392 Identity:150/392 - (38%)
Similarity:226/392 - (57%) Gaps:30/392 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNNWAKGH 111
            :..:::|.|.      ||:|||.:.:||||..::.||.|.|..||.|:..|.|:..|.||:|:|.
  Rat     8 LDTFFHETST------GKHVPRTLFMDLEPTVIDGVRVGKYHSLFHPEQLVNGKEDAANNYARGR 66

  Fly   112 YTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVV 176
            |:                .|.|..||||.:..|.|||||||..:||:.::..||..:....:||.
  Rat    67 YS----------------AEQCSGLQGFLIYRSFGGGTGSGFTSLLMERLSVEYCKKTKLEFSVY 115

  Fly   177 PSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSG 241
            |||::|..|||||||.|:.|..:|.:|.|:.:||||:|:||.|.|.|.:|||..:|.|::..:|.
  Rat   116 PSPRISTAVVEPYNAILTTHSTIEYSDCTFMVDNEAVYNICHRKLGVEHPSYSSINRLIAQVLSS 180

  Fly   242 VTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM 306
            :|..|||.|.||.||.:...|:||:||:||.:...||:.|........|:||::|...|:..|.:
  Rat   181 ITASLRFEGPLNVDLIEFQTNLVPYPRIHFPITTLAPIISAEKAYQEHLSVPDITASCFELSNQL 245

  Fly   307 AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAV-CDIP---PKG- 366
            ..||||.|:|:....::||.:..|:|:|.:.|::::.|..||:|.|...|..: |..|   |.| 
  Rat   246 VKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKSRTSVQFVDWCPTGFKVGINCQPPTVVPGGD 310

  Fly   367 ---LKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEY 428
               ::.:...:.|||||.|.:.|:..:|..|:.:|||||||..|||:..||.||..::..|..:|
  Rat   311 LARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITEGMELGEFEEAREDLAALEKDY 375

  Fly   429 QQ 430
            ::
  Rat   376 EE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub60DNP_523842.2 PLN00220 1..450 CDD:215107 150/392 (38%)
beta_tubulin 2..432 CDD:276956 150/392 (38%)
Tubal3NP_001099588.1 alpha_tubulin 7..378 CDD:276955 150/392 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.