DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fatp3 and hll

DIOPT Version :9

Sequence 1:NP_726437.2 Gene:Fatp3 / 37887 FlyBaseID:FBgn0034999 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_609696.1 Gene:hll / 34822 FlyBaseID:FBgn0286723 Length:681 Species:Drosophila melanogaster


Alignment Length:556 Identity:116/556 - (20%)
Similarity:194/556 - (34%) Gaps:153/556 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LSFAEALEFSQKIAGYFSDRGLERGDCVALLMETRLEYPCIWLGLSQLGVITALINSNLRGESLL 203
            |:|.|..|..::.|......|:|....|.:|.....|:.....|..:.|.:.|.:..:...|::.
  Fly    70 LTFGEYQERVEQAALMLLSVGVEERSSVGILAFNCPEWFFAEFGALRAGAVVAGVYPSNSAEAVH 134

  Fly   204 HSIKVANAKALIVGSELLDVLVSLRE-KEQLDEV--------PIYQYTDDEVRGVAGHDLLPGAV 259
            |.:....:...:|..  ...:..||. ||:|..:        |...:.|.|          ||..
  Fly   135 HVLATGESSVCVVDD--AQQMAKLRAIKERLPRLKAVIQLHGPFEAFVDHE----------PGYF 187

  Fly   260 DLVTALKTQKKLELPSAVCPGEARSK----LLYVYTSGTTGLPKAAVIT--NLRFLFMSAGSYYM 318
            ......:.....||...:...|:|.:    .:.::||||.|:|||.:::  ||.|...||.::..
  Fly   188 SWQKLQEQTFSSELKEELLARESRIRANECAMLIFTSGTVGMPKAVMLSHDNLVFDTKSAAAHMQ 252

  Fly   319 -LKMSSDDVVYDPLPLYHTAGGI----VGVGNA---------ILNGSTV-VLRKKFSARNFWLDC 368
             :::..:..| ..|||.|.|..|    :|:.:|         .|.|:.: ..||....:.|.:. 
  Fly   253 DIQVGKESFV-SYLPLSHVAAQIFDVFLGLSHAGCVTFADKDALKGTLIKTFRKARPTKMFGVP- 315

  Fly   369 DRHNCTVAQYIGE-----------LCRYLLATSYSPDQQKHNLRLM-------YGNG-------- 407
                 .|.:.:.|           ..|.|||.:.:. ..:|...||       |||.        
  Fly   316 -----RVFEKLQERLVAAEAKARPYSRLLLARARAA-VAEHQTTLMAGKSPSIYGNAKYWLACRV 374

  Fly   408 ---LRPQIWSQFVRRF---GIP--------------HIGEIYGATEGNSNL---INITNRVGAIG 449
               :|..|.....|.|   |.|              .:||.||.:|.:..:   ::|:|...|  
  Fly   375 VKPIREMIGVDNCRVFFTGGAPTSEELKQFFLGLDIALGECYGMSETSGAITLNVDISNLYSA-- 437

  Fly   450 FVPVYGSSLYPVQVLRCDEYTGELLKDSKGHCIRCQPGQAGLLVGKVDARRAVSAFHGYADKGAS 514
                 |.:        |:   |..||..:..|    .||..:|:      |....|.||......
  Fly   438 -----GQA--------CE---GVTLKIHEPDC----NGQGEILM------RGRLVFMGYLGLPDK 476

  Fly   515 EQKLLRNVFTSGDVFFNSGDMVVRDILGYFYFKDRTGD-TFRWRGENVATQEVEAIITNCVGLED 578
            .::.::.     |.:.:|||:...|..|......|..: .....|||:....:|.:|..      
  Fly   477 TEETVKE-----DGWLHSGDLGYIDPKGNLIISGRLKELIITAGGENIPPVHIEELIKK------ 530

  Fly   579 CVVYGVQIPHVEGKAGMAAIVDPERKVDMDYLSVVL 614
                  ::|.|..    ..::...||    ||:|:|
  Fly   531 ------ELPCVSN----VLLIGDHRK----YLTVLL 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fatp3NP_726437.2 PRK08279 90..684 CDD:236217 116/556 (21%)
hsFATP4_like 136..653 CDD:213305 116/556 (21%)
hllNP_609696.1 AFD_class_I 62..680 CDD:388389 116/556 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.