DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3376 and CG32052

DIOPT Version :9

Sequence 1:NP_001246491.1 Gene:CG3376 / 37884 FlyBaseID:FBgn0034997 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001303410.1 Gene:CG32052 / 326184 FlyBaseID:FBgn0044328 Length:509 Species:Drosophila melanogaster


Alignment Length:477 Identity:115/477 - (24%)
Similarity:178/477 - (37%) Gaps:111/477 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 HISDTHYDPHYAEGSN--ADCNEPLCCRLSSGRPATPNAAA----GKWGDYRKCDTPKRTVDHML 361
            ||||.|.|..|:...:  ..|.|  ..|..||..|  |:||    |.:|.| .||:|.|.::..:
  Fly    30 HISDLHLDTLYSTQGDIYRSCWE--LARSVSGSNA--NSAASEPPGPFGHY-NCDSPWRLIESAV 89

  Fly   362 SHI-AETHKDIDYILWTGDLPPHDVWNQTKEENLAIIKDTVKQMVEMFPGVPIFPALGNHESAPV 425
            ..: |:...:::::|||||...|.....::::...|:::..:.:...|....|||.|| ||..  
  Fly    90 KTMKAKQGDNVEFVLWTGDALSHSAQPLSEQKQHEILRNITELLGRSFSSQFIFPVLG-HEDG-- 151

  Fly   426 NSFPPPYVNQVDISISWLYDELDIQWRRWLPQSVTHTVRRGAFYSV-LVRPGFRIISLNMNYCNN 489
                           |..|..|...||.|||.....|..:|.:||: ..:...||::||.|:.. 
  Fly   152 ---------------SGSYRRLGELWRHWLPSEALVTFDQGGYYSIEQTKSRLRIVALNTNFMR- 200

  Fly   490 KNWWLLLNSTDPATEL-----------------------------QWFIYE--LQSAEFSNEKVH 523
                 |....||...|                             ||...|  |..::...|.|:
  Fly   201 -----LDPDPDPRASLSLRWPAEYFAEPKASVSSISAEDELLAEQQWLWLEEVLTKSKEKQETVY 260

  Fly   524 VIGHIPPG---------HSDCLKVWSRN---FYKIISRYESTVTAQFYGHTHYDEFEMFYDPHDL 576
            ::||:|||         |:. |....||   :..::.|:...:..||:||.|.|.|.:.||..  
  Fly   261 IVGHMPPGVDERHLGTQHNQ-LTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDTFRLIYDAK-- 322

  Fly   577 NHPNGIAYIGPSVSPY-----YDLNPGYRIYYVDGDHDATTRLVIDHESWIMNLKEANLYGYPIW 636
            .:|.....|.||:.|.     ...||..|:|    ..|..:..|:|:..:.::|..||....|.|
  Fly   323 GNPISWLMIAPSIVPRKAGIGSSNNPALRLY----KFDTGSGQVLDYTQFWLDLPLANRANEPTW 383

  Fly   637 YKLYTARAAYNMKALRPSDWNNLLNELTNNQELFELYYKYYWKNS---PARPTCDAECKKRLICD 698
            ...|.....|.:..:.....:|.....|...  ...:.:|:..|:   .:...|...|.      
  Fly   384 QPEYNLTHYYALPEISAVALHNFAERFTGTD--LSWFTRYHRANAVRYHSGSACPGLCM------ 440

  Fly   699 CRSGRSHDRKHFCAEVESKIDE 720
                    ..|:||......||
  Fly   441 --------LNHYCAITRLDYDE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3376NP_001246491.1 SapB 186..258 CDD:214797
Metallophos 299..563 CDD:278574 80/310 (26%)
MPP_ASMase 301..600 CDD:277321 92/352 (26%)
CG32052NP_001303410.1 MPP_ASMase 28..351 CDD:277321 92/352 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452744
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369165at33208
OrthoFinder 1 1.000 - - FOG0000551
OrthoInspector 1 1.000 - - otm46555
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R975
SonicParanoid 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.