DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3376 and Smpdl3a

DIOPT Version :9

Sequence 1:NP_001246491.1 Gene:CG3376 / 37884 FlyBaseID:FBgn0034997 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001005539.1 Gene:Smpdl3a / 294422 RGDID:1359277 Length:445 Species:Rattus norvegicus


Alignment Length:435 Identity:132/435 - (30%)
Similarity:205/435 - (47%) Gaps:50/435 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 PDLPIPMEAAPFF------KVLHISDTHYDPHYAEGSNADCNEPLCCRLSSGRPATPNAAAGKWG 345
            |.|.:|:  ||.:      :..|::|.|.||.|   ...|.:..:|........:.|    |.:|
  Rat    19 PGLGVPL--APAYGAPAVGQFWHVTDLHLDPTY---HITDDHTKVCASSKGANVSNP----GPFG 74

  Fly   346 DYRKCDTPKRTVDHMLSHIAETHKDIDYILWTGDLPPH-DVWNQTKEENLAIIKDTVKQMVEMFP 409
            |. .||:|.:.:......|..:.::..:::||||.||| .|...:....:.:|.:....:..:||
  Rat    75 DV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVRELSTGSVIEVITNMTVTVQNLFP 138

  Fly   410 GVPIFPALGNHESAPVNSFPPPYVNQVDISISWLYDELDIQWRRWLPQSVTHTVRRGAFYS--VL 472
            .:.:|||||||:..|.:..|        |:.|.:|..:...|:.||.:....|:|:|.|||  |.
  Rat   139 NLQVFPALGNHDYWPQDQLP--------IATSKVYSAVSDLWKPWLDEEAISTLRKGGFYSQKVA 195

  Fly   473 VRPGFRIISLNMNYCNNKNWWLLLNSTDPATELQWFIYELQSAEFSNEKVHVIGHIPPGH----- 532
            ..|..||||||.|.....| .:.||.||||.:.:|....|.|:..:.|||:||.|:|.|:     
  Rat   196 SNPDLRIISLNTNLYYGPN-IMTLNKTDPANQFEWLENTLNSSLRNKEKVYVIAHVPVGYLPYAT 259

  Fly   533 --SDCLKVWSRNFYKIISRYESTVTAQFYGHTHYDEFEMFYDPHDLNHPNGIAYIGPSVSPYYDL 595
              ....:.::.....|..||.|.:..|||||||.|...:..|.:  .:|....::.|:|:|...:
  Rat   260 KTPAMRQYYNEKLVDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GNPINSVFVAPAVTPVKGV 322

  Fly   596 ------NPGYRIY-YVDGDHDATTRLVIDHESWIMNLKEANLYGYPIWYKLYTARAAYNMKALRP 653
                  |||.|:: |..||:     .::|...:.:||.||||.|...|...||...||.:..|:|
  Rat   323 LEKETNNPGVRLFQYKPGDY-----TLLDMLQYYLNLTEANLKGESNWTLEYTLTQAYGVADLQP 382

  Fly   654 SDWNNLLNEL-TNNQELFELYYKYYWKNSPARPTCDAECKKRLIC 697
            ...:.|..:| |.:.:.|..||.|::.:..:...||..||...||
  Rat   383 KSLHGLAQQLATIDSKQFLKYYHYFFVSYDSSAPCDQRCKTLQIC 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3376NP_001246491.1 SapB 186..258 CDD:214797
Metallophos 299..563 CDD:278574 84/279 (30%)
MPP_ASMase 301..600 CDD:277321 95/314 (30%)
Smpdl3aNP_001005539.1 MPP_ASMase 37..333 CDD:277321 95/314 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53732
OrthoDB 1 1.010 - - D1142100at2759
OrthoFinder 1 1.000 - - FOG0000551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.