DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3376 and SMPDL3A

DIOPT Version :9

Sequence 1:NP_001246491.1 Gene:CG3376 / 37884 FlyBaseID:FBgn0034997 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_006705.1 Gene:SMPDL3A / 10924 HGNCID:17389 Length:453 Species:Homo sapiens


Alignment Length:437 Identity:125/437 - (28%)
Similarity:201/437 - (45%) Gaps:47/437 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 PPVPKPPRLPDLPIPMEAAPFFKVLHISDTHYDPHYAEGSNADCNEPLCCRLSSGRPATPNAAAG 342
            |..|...|.|    |.....|:   |::|.|.||.|   ...|.:..:|........:.|    |
Human    24 PVAPAGGRNP----PPAIGQFW---HVTDLHLDPTY---HITDDHTKVCASSKGANASNP----G 74

  Fly   343 KWGDYRKCDTPKRTVDHMLSHIAETHKDIDYILWTGDLPPH-DVWNQTKEENLAIIKDTVKQMVE 406
            .:||. .||:|.:.:......|..:.::..:::||||.||| .|...:.:..:.:|.:....:..
Human    75 PFGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQS 138

  Fly   407 MFPGVPIFPALGNHESAPVNSFPPPYVNQVDISISWLYDELDIQWRRWLPQSVTHTVRRGAFYS- 470
            :||.:.:|||||||:..|.:..|        :..|.:|:.:...|:.||.:....|:|:|.||| 
Human   139 LFPNLQVFPALGNHDYWPQDQLP--------VVTSKVYNAVANLWKPWLDEEAISTLRKGGFYSQ 195

  Fly   471 -VLVRPGFRIISLNMNYCNNKNWWLLLNSTDPATELQWFIYELQSAEFSNEKVHVIGHIPPGH-- 532
             |...|..||||||.|.....| .:.||.||||.:.:|....|.:::.:.|||::|.|:|.|:  
Human   196 KVTTNPNLRIISLNTNLYYGPN-IMTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLP 259

  Fly   533 -----SDCLKVWSRNFYKIISRYESTVTAQFYGHTHYDEFEMFYDPHDLNHPNGIAYIGPSVSPY 592
                 :...:.::.....|..:|...:..|||||||.|...:..|..  ..|....::.|:|:|.
Human   260 SSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKK--GSPVNSLFVAPAVTPV 322

  Fly   593 YDL------NPGYRIYYVDGDHDATTRLVIDHESWIMNLKEANLYGYPIWYKLYTARAAYNMKAL 651
            ..:      |||.|::    .:|.....::|...:.:||.||||.|..||...|.....|:::.|
Human   323 KSVLEKQTNNPGIRLF----QYDPRDYKLLDMLQYYLNLTEANLKGESIWKLEYILTQTYDIEDL 383

  Fly   652 RPSDWNNLLNELT-NNQELFELYYKYYWKNSPARPTCDAECKKRLIC 697
            :|.....|..:.| .:.:.|..||.|::.:..:..|||..||...||
Human   384 QPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTCDKTCKAFQIC 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3376NP_001246491.1 SapB 186..258 CDD:214797
Metallophos 299..563 CDD:278574 79/273 (29%)
MPP_ASMase 301..600 CDD:277321 90/314 (29%)
SMPDL3ANP_006705.1 MPP_ASMase 40..336 CDD:277321 91/317 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53732
OrthoDB 1 1.010 - - D1142100at2759
OrthoFinder 1 1.000 - - FOG0000551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R975
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.