DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13575 and tacr3l

DIOPT Version :9

Sequence 1:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001243564.1 Gene:tacr3l / 559201 ZFINID:ZDB-GENE-061207-19 Length:395 Species:Danio rerio


Alignment Length:451 Identity:92/451 - (20%)
Similarity:161/451 - (35%) Gaps:138/451 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FSAVVGTLFVLAFCGNLSTLY-VNSRRKLRPFFRACLISLACSDLVSSIFCT-VSYMAQFQAQYL 115
            :|....::..:|..|||..:: :.:.:::|......|::||.||...:.|.| ::::.....:  
Zfish    28 WSVAYSSVLAVAVFGNLIVIWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLINFIYATHGE-- 90

  Fly   116 QLWTIGGFMCKFVPFITTTSVLSGSLTLVAIALDRYLAVMRPVLGFWSPDKRFSTLS----MLLI 176
              |..|...|||..|...|:|.:...::.|||:|||:|::.|:      ..|.|..:    ::.|
Zfish    91 --WYFGEVYCKFHNFFPVTAVFASIYSMTAIAVDRYMAIIHPL------KPRLSATATKVVIVCI 147

  Fly   177 WACSIGSSGPLLGIYDYRKIYLLDVEDSSEESEEVVTAVPEELVVTELEMVHMCLAG----DHDV 237
            ||.::..:.||.       .|            .....:|...:         |...    ..|.
Zfish   148 WALAVILAFPLC-------FY------------STTRTMPRRTI---------CYVAWPRPAEDS 184

  Fly   238 GLYYVILFTLIF-LPCIVSFLWLNAVIARQLWLRRHYHQEQQEQHQEPKEGQFKTMANGGDLLMP 301
            .:|::|:..|:: ||.:|..: ...::...||                          ||:    
Zfish   185 FMYHIIVTVLVYMLPLVVMGI-TYTIVGVTLW--------------------------GGE---- 218

  Fly   302 STLVSAMGVAVPFALDNTPLPPKSTVNAPGKKTTAAALAREARHRKMVVVVLLMMAVFICLRLPA 366
                               :|..|:.|..|:...         .||:|.::::::..|....||.
Zfish   219 -------------------IPGDSSDNYVGQLRA---------KRKVVKMMIVVVVTFALCWLPY 255

  Fly   367 WVFLIMRLYGSYSEPIDW----LLYFSFGILNLFSCALNPIFYTFLTQTIRTLTLVKHKIQGFLG 427
            .::.|:.  |.......|    .:|.|...|.:.|...|||.|..|....|    ...| :.|..
Zfish   256 HIYFIVT--GLNKRLNKWKSIQQVYLSVLWLAMSSTMYNPIIYCCLNGRFR----AGFK-RAFRW 313

  Fly   428 CPPGKVPDGMPTDQMDKSGCCCGLRPPTFTWRCHPSRDRAAATVIRDVDQ----PDPPSDQ 484
            ||..:|..   .|:::       |||.    |.||....:..|:.| ||.    .||...|
Zfish   314 CPFIQVSS---YDELE-------LRPT----RLHPRNQSSMCTLSR-VDTSLHGEDPRRSQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431 33/126 (26%)
tacr3lNP_001243564.1 7tm_4 32..>160 CDD:304433 35/144 (24%)
7tm_1 42..296 CDD:278431 68/352 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.