DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13575 and RYa-R

DIOPT Version :9

Sequence 1:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster


Alignment Length:425 Identity:99/425 - (23%)
Similarity:160/425 - (37%) Gaps:133/425 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LFVLAFCGNLSTLY-VNSRRKLRPFFRACLISLACSDLVSSIFCT-VSYMAQFQAQYLQLWTIGG 122
            :|:.|..||.:..| |.|..::|......:.|||..|::.|.||. .|:::.|...|   |..|.
  Fly   115 IFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNY---WPFGL 176

  Fly   123 FMCKFVPFITTTSVLSGSLTLVAIALDRYLAVMRPVLGFWSP--DKRFSTLSMLLIWACSIGSSG 185
            .:|.||.:....|||..:.|||||::|||:|:|.|:    .|  .||::|..:..:|..::.::.
  Fly   177 ALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPL----KPRITKRYATFIIAGVWFIALATAL 237

  Fly   186 PLLGIYDYRKIYLLDVEDSSEESEEVVTA--VPEELVVTELEMVHMC--LAGDHDVGLYYVI-LF 245
            |:                      .:|:.  :|.....|:.|. ::|  :........||.: ||
  Fly   238 PI----------------------PIVSGLDIPMSPWHTKCEK-YICREMWPSRTQEYYYTLSLF 279

  Fly   246 TLIFLPCIVSFLWLNAVIARQLWLRRHYHQEQQEQHQEPKEGQFKTMANGGDLLMPSTLVSAMGV 310
            .|.|:..:...::..|.|..::|.:|                                       
  Fly   280 ALQFVVPLGVLIFTYARITIRVWAKR--------------------------------------- 305

  Fly   311 AVPFALDNTPLPPKSTVNAPGKKTTAAALAREARHRKMVVVVLLMMAVFICLRLPAWVFLIMRLY 375
                              .||:..|..........||||.::|.::.||.|..||   |.|::|.
  Fly   306 ------------------PPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLP---FNILQLL 349

  Fly   376 GSYSEPIDW----LLYFSFGILNLFSCALNPIFYTFLTQTIRTLTLVKHKIQGFLGCPPGKVPDG 436
            .:..|...|    .::|:|..|.:..|..|||.|.::....|:         ||:     ::...
  Fly   350 LNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARFRS---------GFV-----QLMHR 400

  Fly   437 MPTDQMDKSGCCCGLRPPTFTWRCHPS-RDRAAAT 470
            ||           |||    .|.|..| .||..||
  Fly   401 MP-----------GLR----RWCCLRSVGDRMNAT 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431 41/124 (33%)
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 42/125 (34%)
7tm_1 122..383 CDD:278431 81/350 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24238
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.