DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13575 and CCHa2-R

DIOPT Version :9

Sequence 1:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster


Alignment Length:394 Identity:84/394 - (21%)
Similarity:144/394 - (36%) Gaps:122/394 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IQPYPGVFVGDLSQLNRFKRHAFSAVVGTLFVLAFCGNLSTLYVNSR-RKLRPFFRACLISLACS 94
            |.||..|       |:|.:.:..:.:...:|::...||.:.:.:..| |.:|......::|||.:
  Fly    57 IVPYVPV-------LDRPETYIVTVLYTLIFIVGVLGNGTLVIIFFRHRSMRNIPNTYILSLALA 114

  Fly    95 DLVSSIFC----TVSYMAQFQAQYLQLWTIGGFMCKFVPFITTTSVLSGSLTLVAIALDRYLAVM 155
            ||:..:.|    |:.|..       :.|.....||:...|....|:.....||.|::.:||.|::
  Fly   115 DLLVILVCVPVATIVYTQ-------ESWPFERNMCRISEFFKDISIGVSVFTLTALSGERYCAIV 172

  Fly   156 RPVLGFWSPDKRFSTLSMLLIWACSIGSSGPLLGIYDYRKIYLLDVEDSSEESEEVVTAVPEELV 220
            .|:....:  |..:..:.::||..:|     |||:   ..:...|:     :|..|.||      
  Fly   173 NPLRKLQT--KPLTVFTAVMIWILAI-----LLGM---PSVLFSDI-----KSYPVFTA------ 216

  Fly   221 VTELEMVHMCLAGDHDVGLYYVILFTLIFLPCIVSFLWLNAVIARQLWLRRHYHQEQQEQHQEPK 285
             |....:.:|                                                ...::|:
  Fly   217 -TGNMTIEVC------------------------------------------------SPFRDPE 232

  Fly   286 EGQFKTMANGGDL---LMPSTLVSAMGVAVPFALDNTPLPPKSTVNAPGK------KTTAAALAR 341
            ..:|  |..|..|   |:|.:::.|:.:.:...|.      .|..|.||:      :|.|.|...
  Fly   233 YAKF--MVAGKALVYYLLPLSIIGALYIMMAKRLH------MSARNMPGEQQSMQSRTQARARLH 289

  Fly   342 EARHRKMVVVVLLMMAVFICLRLPAWVF-LIMRLYGSYSEPID--W----LLYFSFGILNLFSCA 399
            .||     :||..::..|||. .|..|| |....|.:..|..|  |    ::.|....||  || 
  Fly   290 VAR-----MVVAFVVVFFICF-FPYHVFELWYHFYPTAEEDFDEFWNVLRIVGFCTSFLN--SC- 345

  Fly   400 LNPI 403
            :||:
  Fly   346 VNPV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431 29/125 (23%)
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 78/374 (21%)
TM helix 1 71..97 CDD:320593 3/25 (12%)
TM helix 2 104..130 CDD:320593 7/25 (28%)
TM helix 3 142..172 CDD:320593 9/29 (31%)
TM helix 4 182..202 CDD:320593 6/27 (22%)
TM helix 5 234..259 CDD:320593 7/26 (27%)
TM helix 6 285..315 CDD:320593 12/35 (34%)
TM helix 7 330..355 CDD:320593 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.