DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13575 and Tacr2

DIOPT Version :9

Sequence 1:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_542946.1 Gene:Tacr2 / 25007 RGDID:3812 Length:390 Species:Rattus norvegicus


Alignment Length:414 Identity:85/414 - (20%)
Similarity:138/414 - (33%) Gaps:165/414 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LFVLAFCGNLSTLY-VNSRRKLRPFFRACLISLACSDLVSSIFCTVSYMAQFQAQYL--QLWTIG 121
            |.::|..||.:.:: :.:..::|......:|:||.:||     |..::.|.|...|.  .:|..|
  Rat    43 LVLVAVTGNATVIWIILAHERMRTVTNYFIINLALADL-----CMAAFNATFNFIYASHNIWYFG 102

  Fly   122 GFMCKFVPFITTTSVLSGSLTLVAIALDRYLAVMRP-------------VLGFW-------SPDK 166
            ...|.|......|::.....::.|||.|||:|::.|             :.|.|       ||..
  Rat   103 RAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAIIAGIWLVALALASPQC 167

  Fly   167 RFSTLSMLLIWACSIGSSGPLLGIYDYRKIYLLDVEDSSEESEEVVTAVPEELVVTELEMVHMCL 231
            .:||:::                               .|.:.:.|.|.|.:             
  Rat   168 FYSTITV-------------------------------DEGATKCVVAWPND------------- 188

  Fly   232 AGDHDVGLYYVILFTLI-FLPCIVSFLWLNAVIARQLWLR---RHYHQEQQEQHQEPKEGQFKTM 292
            .|...:.||::::|.|| |||.:|.| ...:||...||.|   ||                   .
  Rat   189 NGGKMLLLYHLVVFVLIYFLPLLVMF-GAYSVIGLTLWKRAVPRH-------------------Q 233

  Fly   293 ANGGDLLMPSTLVSAMGVAVPFALDNTPLPPKSTVNAPGKKTTAAALAREARH----RKMVVVVL 353
            |:|.:|                                             ||    :|.|..::
  Rat   234 AHGANL---------------------------------------------RHLQAKKKFVKAMV 253

  Fly   354 LMMAVFICLRLPAWVFLIMRLYGSYSEPIDWLLYFSFGILNLFSCAL-----NPIFYTFLTQTIR 413
            |::..|....||..::.|:   |::.|.|.:..:.....|.||..|:     |||.|..|....|
  Rat   254 LVVLTFAICWLPYHLYFIL---GTFQEDIYYHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFR 315

  Fly   414 TLTLVKHKIQGF---LGCPPGKVP 434
            :         ||   ..|.|...|
  Rat   316 S---------GFRLAFRCCPWVTP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431 31/143 (22%)
Tacr2NP_542946.1 7tm_4 42..>168 CDD:304433 31/129 (24%)
7tm_1 50..307 CDD:278431 75/373 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.