DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13575 and Tacr1

DIOPT Version :9

Sequence 1:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_036799.1 Gene:Tacr1 / 24807 RGDID:3811 Length:407 Species:Rattus norvegicus


Alignment Length:416 Identity:83/416 - (19%)
Similarity:150/416 - (36%) Gaps:123/416 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YPGVFVGDLSQLNRFKRHA-----FSAVVGTLFVLAFCGNLSTLY-VNSRRKLRPFFRACLISLA 92
            :|.:.. :.|:.|:|.:..     ::|....:.|.:..||:..:: :.:.:::|......|::||
  Rat    12 FPNIST-NTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAHKRMRTVTNYFLVNLA 75

  Fly    93 CSDLVSSIFCTVSYMAQFQAQYLQLWTIGGFMCKFVPFITTTSVLSGSLTLVAIALDRYLAVMRP 157
            .::...:.|.||   ..|......:|..|.|.|||..|....::.:...::.|:|.|||:|::.|
  Rat    76 FAEACMAAFNTV---VNFTYAVHNVWYYGLFYCKFHNFFPIAALFASIYSMTAVAFDRYMAIIHP 137

  Fly   158 VLGFWSPDKRFSTLS----MLLIWACSIGSSGPLLGIYDYRKIYLLDVEDSSEES--EEVVTAV- 215
            :      ..|.|..:    :.:||..::..:.| .|.|            |:.|:  ..||..: 
  Rat   138 L------QPRLSATATKVVIFVIWVLALLLAFP-QGYY------------STTETMPSRVVCMIE 183

  Fly   216 -PEELVVTELEMVHMCLAGDHDVGLYYVILFTLIFLPCIVSFLWLNAVIARQLWLRRHYHQEQQE 279
             ||....|..:..|:|:.         |:::   |||.:| ..:...|:...||...........
  Rat   184 WPEHPNRTYEKAYHICVT---------VLIY---FLPLLV-IGYAYTVVGITLWASEIPGDSSDR 235

  Fly   280 QHQEPKEGQFKTMANGGDLLMPSTLVSAMGVAVPFALDNTPLPPKSTVNAPGKKTTAAALAREAR 344
            .|::                     |||                                     
  Rat   236 YHEQ---------------------VSA------------------------------------- 242

  Fly   345 HRKMVVVVLLMMAVFICLRLPAWVFLIMRLYGSYSEPIDWL------LYFSFGILNLFSCALNPI 403
            .||:|.::::::..|....||..||.::    .|..|..:|      :|.:...|.:.|...|||
  Rat   243 KRKVVKMMIVVVCTFAICWLPFHVFFLL----PYINPDLYLKKFIQQVYLASMWLAMSSTMYNPI 303

  Fly   404 FYTFLTQTIRTLTLVKHKIQGFLGCP 429
            .|..|....|  ...||   .|..||
  Rat   304 IYCCLNDRFR--LGFKH---AFRCCP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431 29/125 (23%)
Tacr1NP_036799.1 7tm_1 54..305 CDD:278431 67/347 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.