DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13575 and R13H4.7

DIOPT Version :9

Sequence 1:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001256380.1 Gene:R13H4.7 / 187874 WormBaseID:WBGene00011265 Length:347 Species:Caenorhabditis elegans


Alignment Length:270 Identity:51/270 - (18%)
Similarity:81/270 - (30%) Gaps:113/270 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 VGLYYVILFTLIFLPCIVSF-LWLNAVIARQ------------------LWLRRHYHQ-----EQ 277
            ||..::|...|..:..::.| :|...||..|                  .|....||.     .:
 Worm    38 VGFRFLISQALTDILLMIQFGIWPGIVILTQNEIINESWRWNIHIYLDFTWWAMVYHYTVIAWSR 102

  Fly   278 QEQHQEPKEGQFKTMANGGDLLMPSTLVSAMGVAVPF---ALDN---------TPL---PPKSTV 327
            ....|.|  ..|:|:.:|         .|.|..|:|:   .|.:         |||   |.:..:
 Worm   103 LAAVQWP--NWFRTLPHG---------TSIMICAIPWFTGLLQSLVEHQFDWFTPLFYSPTRYGM 156

  Fly   328 NAPGKKTTAAALAREARHRKMVVVVLLMMAVFICLRLPAWVFLI-----------MRLYGSYSE- 380
            ::..:|...:.    .....||..|:||:..|     |.:|..:           |:|...||. 
 Worm   157 HSDWEKYELSG----TNTYYMVCNVILMVVPF-----PLYVLALAVLFQRQTSRNMQLRSKYSHA 212

  Fly   381 PIDWLLY-----------------------FSFGILNLFSCA-------------------LNPI 403
            ||....|                       |..|.:.:..|:                   :||:
 Worm   213 PISTSSYAAQQRQLSIETRLLVPCIINTILFVVGQVFISQCSKHGKWMNWAVMVVFATNSFVNPL 277

  Fly   404 FYTFLTQTIR 413
            .|.|.:..||
 Worm   278 LYLFFSSVIR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431
R13H4.7NP_001256380.1 7tm_GPCRs 6..283 CDD:333717 49/264 (19%)
TM helix 1 6..29 CDD:320095
TM helix 2 40..63 CDD:320095 4/22 (18%)
TM helix 3 79..100 CDD:320095 3/20 (15%)
TM helix 4 122..143 CDD:320095 4/20 (20%)
TM helix 5 169..192 CDD:320095 8/27 (30%)
TM helix 7 258..283 CDD:320095 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.