DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nord and LOC100488368

DIOPT Version :9

Sequence 1:NP_611900.1 Gene:nord / 37882 FlyBaseID:FBgn0050418 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_002939769.2 Gene:LOC100488368 / 100488368 -ID:- Length:557 Species:Xenopus tropicalis


Alignment Length:442 Identity:93/442 - (21%)
Similarity:161/442 - (36%) Gaps:109/442 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 WPLLNATHRIAIRTQNRVRKREMIVKWERSKFDF---HVMHYCLVIQRLSMDTPRMIFTNFC--- 244
            :|.|....||.:.|.|.   ..:.:.|:.|....   ..:.|||::..      :..:.:.|   
 Frog   176 FPELPGDPRIDVTTLNH---NSVSLVWKPSPTGLKTREYVEYCLLVNE------KHNYKSLCAAD 231

  Fly   245 QAVSAYTDQQPMTPSCAAGGPLEGIWGAP--PQRERRLNPRQN---VHIVCTGKRRQQLLRRLLP 304
            .||.:.:.|:.|..:......::...|..  ..||..:..|.|   |..:|.|.:....:..|..
 Frog   232 AAVRSISGQRTMFSNVPVSQHIDDHQGVMHLSNREFSIIQRTNNMEVRQICIGNKNVYTVSNLTS 296

  Fly   305 RSSYHLDLFGIHQGRQNLTLRLASSQVNFNRT------QP----LALKQQALMQLKIGGQHGKQV 359
            .:.|:.|:|.:     ||   |.:..|.:..|      :|    ..||...::|:.:.|:..|. 
 Frog   297 NTQYYFDVFVV-----NL---LTNGSVAYTGTFAKTLMEPKPKYSQLKDGKIVQITLNGKLQKS- 352

  Fly   360 YSFKVPQTTRQLGEPFMRHLLIPCSGSEIRVKLLRQRSEVGK---TEAFYSPTYIRQKGVLPGER 421
            .:|:...|.:::...|.     .|.| ::|.::|:.    ||   :|:.....:|...|     :
 Frog   353 NTFQYQATHKKVQFTFQ-----SCKG-QVRAQILKN----GKILFSESIEGLRHITLTG-----K 402

  Fly   422 YLMRFEPSNDDEALRAQKVMVALSS---EALFRDLPELPQNTTV--FNVRTRCSRATIAWNGSPD 481
            .|.::......|......|||..||   :.||   |..|.:..:  ||....|:..||||.|: .
 Frog   403 ILEKYVVVTSTEQNTNSSVMVQASSHIHKPLF---PFFPDSLKIRSFNKLRTCNSITIAWLGT-Q 463

  Fly   482 ERELSYCIIVFNLPQRNRSVVDFTNYCMDFVPKRVMQYRYFEWMTCRERQQSPDN---------- 536
            ||.| ||:                      ..|::.:.:.::.|:..:|...||:          
 Frog   464 ERNL-YCV----------------------YKKKIQEDQVWKEMSNHDRCLGPDSRPKSEKVSCK 505

  Fly   537 ----------IETETILNLMPGSSYLVYVTANLSMGKPLPYQALTLHMASQC 578
                      :.||.|..|..||.||:.|....|.|..:.|....:.....|
 Frog   506 YFYNINLQKAVTTEIITGLERGSLYLIDVYLVGSPGILVRYHTKVVKTRKHC 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nordNP_611900.1 DUF2369 286..578 CDD:287188 71/329 (22%)
LOC100488368XP_002939769.2 DUF2369 281..373 CDD:401987 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5274
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D152874at33208
OrthoFinder 1 1.000 - - FOG0004105
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5574
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.