DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60a and gria1a

DIOPT Version :9

Sequence 1:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_991161.1 Gene:gria1a / 798689 ZFINID:ZDB-GENE-020125-1 Length:914 Species:Danio rerio


Alignment Length:148 Identity:28/148 - (18%)
Similarity:55/148 - (37%) Gaps:46/148 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 LQDAHTWYIKMADRRPAWQ-ALVGIFEAYTWIGFILILIISWLFWFTLVMILPEPKYYQQLSLTA 423
            :::::.:.|::   ||..| ||||:.|.|.|..|:                      |...|.:.
Zfish   114 MENSNQFVIQL---RPELQDALVGVIEHYRWSKFV----------------------YMYSSDSG 153

  Fly   424 INALAVTISIAVQERPICETTRLFFMALTLYGLNVVATYTSKMIATFQD-----PGYL---HQLD 480
            ::.|...:..|.:...:            :..:||.....:..:..|||     .|.:   .:|:
Zfish   154 LSVLQKVLDTAAEHNWL------------VTSVNVETMTEASFLKVFQDLDKKKEGQIIIDCELE 206

  Fly   481 ELTEVVAAGIPFGGHEES 498
            .||.::...|..|.:.:|
Zfish   207 RLTSILKKIIELGKNVKS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir60aNP_611901.1 None
gria1aNP_991161.1 Periplasmic_Binding_Protein_Type_1 26..387 CDD:299141 28/148 (19%)
ANF_receptor 36..369 CDD:279440 28/148 (19%)
PBP2_iGluR_AMPA_GluR1 404..806 CDD:270447
Lig_chan 536..836 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.