DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60a and Ir94h

DIOPT Version :9

Sequence 1:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster


Alignment Length:489 Identity:86/489 - (17%)
Similarity:166/489 - (33%) Gaps:161/489 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SMQDYVSGFSPRNCTFFACSSISAPFVEADCILGLEMRILGFMKNRLKFDVNQTCSLE------- 313
            ||.:.|..||....|....|.::.|:.:.     |:.|:.|.:  |.|..:||...|:       
  Fly   130 SMLNVVLYFSRWTRTLNVFSYLAFPYFKL-----LKQRLSGSL--RPKIFINQLKDLQGYKIRVQ 187

  Fly   314 ---------SRGEMDGPANWTGLLGKVQNNECDFVFGGYYPDNEVADHFW--------------- 354
                     |..:..|.....|.|.::..|....:.|    |.:|....|               
  Fly   188 PDLSPPNSFSYRDRHGECQVGGFLWRIVENFSKSLKG----DTQVLYPTWAKAKVSAAEYMIQFT 248

  Fly   355 ---GSD-----TYLQDAH--------------TWYIKMADRRPAWQALVGIFEAYTWIGFILILI 397
               .||     |.:...|              :|...:...:|.  ::..:|......|..|:||
  Fly   249 RNGSSDIGVTTTMITFKHEERYRDYSYPMYDISWCTMLPVEKPL--SVEILFSHVLSPGSALLLI 311

  Fly   398 ISWLFWFTLVMILPEPKYYQQLSLTAINALAVTISIAVQERPICETTRLFFMALTLYGLNVVATY 462
            ::::.:|   :|:|:          .|..|.:|.           ..||..||..::.|.::.:.
  Fly   312 LAFILFF---LIVPQ----------LIKCLGITF-----------RGRLIGMASRIFALVMLCSS 352

  Fly   463 TSKMIATFQDPGYLHQLDELTEVVAAGIP-FGGHEESRDWF----------------ENDDDMWI 510
            ::::::....|....::....:::.:|:. ||...|.  :|                ||.::::.
  Fly   353 SAQLLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSEL--YFLDGGFRAKYASAFHLTENPNELYD 415

  Fly   511 FNGY-NISPEFIPQSKNLEAVKWGQRCILSNRMYTMQSPLADVIYAF-----------------P 557
            ...| |.|..:     .:.:|||       |.:...|...|..::.:                 |
  Fly   416 NRNYFNTSWAY-----TITSVKW-------NVIEAQQRHFAHPVFRYSTDLCFSSETPWGLLIAP 468

  Fly   558 NNVFSSPVQ----MIMKAGFPFLFEMNSIIRLMRDVGIFQKIDADFRYNNTYLNRINKMRPQFPE 618
            .:.:..|:|    .|.:||....:...|...::|...:..|   |:       :|.|.|:|    
  Fly   469 ESFYREPLQHFTLKINQAGLITQWMTQSFHEMVRAGRMTIK---DY-------SRTNLMKP---- 519

  Fly   619 TAIVLTTEHLKGPFFILVVGSCWAALTFIGELII 652
                |..:.|:..:.|..||...:.:.|..||::
  Fly   520 ----LRIQDLRKCWVIFAVGLGTSTVVFTIELLL 549



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.