DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60a and Ir75a

DIOPT Version :9

Sequence 1:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster


Alignment Length:301 Identity:59/301 - (19%)
Similarity:96/301 - (31%) Gaps:108/301 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFMLPEKDLGPDVWKAGVGCLDSFAQIFFF------RNPKERFTRAYNLMLVHAFHLSSPADQIQ 94
            :|:.|   ..|.||....|.|.....:.:.      :..::|:...|...|:..|.:|..|..||
  Fly   328 VFLQP---FSPLVWYLFGGVLSLIGVLLWITFYMECKRMQKRWRLDYLPSLLSTFLISFGAACIQ 389

  Fly    95 EGFSKLINEAVTNP--------------------------GPPDREELFQMRVASDYNITNGTED 133
            .  |.||..:....                          ..|.:.::..||..::.::|.|.| 
  Fly   390 S--SSLIPRSAGGRLIYFALFLISFIMYNYYTSVVVSSLLSSPVKSKIKTMRQLAESSLTVGLE- 451

  Fly   134 KGELILADNYVIVVDSVDRLKEL---MKKKIVEMRS----W------------NPGARFLVLFHN 179
              .|....:|:    :..||.|:   :|:||.....    |            |||  ::.:|..
  Fly   452 --PLPFTKSYL----NYSRLPEIHLFIKRKIESQTQNPELWLPAEQGVLRVRDNPG--YVYVFET 508

  Fly   180 ATCRNRPLGVA-------SNIFKDLME-------MFYVHRVALLYANSTMNYNLLVNDYYSNVNC 230
            ::      |.|       :....||.|       :||.|    |:.|||         |......
  Fly   509 SS------GYAYVERYFTAQEICDLNEVLFRPEQLFYTH----LHRNST---------YKELFRL 554

  Fly   231 RILNVQSVGQCHDGKLY---------PNNAVVKASMQDYVS 262
            |.|.:...|.....:.|         ..|.|:...| :||:
  Fly   555 RFLRILETGVYRKQRSYWVHMKLHCVAQNFVITVGM-EYVA 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir60aNP_611901.1 None
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 56/289 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462756
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.