DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60a and Ir75a

DIOPT Version :10

Sequence 1:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster


Alignment Length:99 Identity:22/99 - (22%)
Similarity:31/99 - (31%) Gaps:15/99 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 SSSVEPDRQSNPAPVGGPPPAYDGDTISLAE----------NPPPYTQEQTDRTTSGIAVIDIPT 263
            :|..|....|.|.    .|..||...|...:          .|||.|..:.....:| .|.:|..
  Fly    18 TSGAEAKAPSRPV----QPYHYDYSRIQETDQAWKCWKEGYRPPPATSNKIHEQGNG-TVAEIER 77

  Fly   264 TTTTDHALSMDLPTDRTSSNLQGITNHAFEPDKL 297
            ....|.:.::.......|.|....|....|.:||
  Fly    78 ILRFDQSNTVLFLFSSNSDNQNLHTTFTVERNKL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir60aNP_611901.1 None
Ir75aNP_649012.2 Periplasmic_Binding_Protein_Type_2 455..572 CDD:473866
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.