DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60a and Ir94c

DIOPT Version :9

Sequence 1:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_732701.2 Gene:Ir94c / 318727 FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster


Alignment Length:329 Identity:72/329 - (21%)
Similarity:133/329 - (40%) Gaps:49/329 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 PAWQAL-----VGIFEAYTWIGFILILIISWLFWFTLVMILPEPKYYQQLSLTAIN------ALA 428
            |.|:.:     :|:.:.   ||.:||....::...||::.|......:::.||::|      |..
  Fly   288 PKWRFMDVLHKLGVLKL---IGCLLIAYAVFVLIETLILWLTHRISGREVRLTSLNQLLNPRAFR 349

  Fly   429 VTISIAVQE-RPICETTRLFFMALTLYGLNVVATYTS-KMIATFQDPGYLHQLDELTEVVAAGIP 491
            ..:.:...| |....:.|..|:.::::|| |.:.:.| .:.|....|....|:....|:..:|:.
  Fly   350 GILGLPFPEFRRSSISLRQLFLVISVFGL-VYSNFVSCTLSALLTKPAQNPQVRNFKELRDSGLI 413

  Fly   492 FGGHEESRDWFENDDDMWIFNGYNISPEF-IPQSKNLEAVKWGQRCILSNRMYTMQ-SPLADVIY 554
            ....:.:..:.|...|...|:  ::.|.: |.|.|....:.|......|..|||.. ..|..|..
  Fly   414 TIMDKYTHSFIEKHIDPEFFD--HVLPHYLILQKKEALRMIWNFNDSYSYVMYTTTWKSLNTVQK 476

  Fly   555 AFPNNVFSSPVQMIMKAGFPFLFEM--NSIIR--------LMRDVGI-------FQKIDADFRYN 602
            :|...||.....:.:....|.::.:  ||:::        .|...||       ..|: ....||
  Fly   477 SFDERVFCESESLTIAWNLPRMYVLGNNSVLKWMLSRYITYMPQTGIPDSWTEQLPKV-LKLLYN 540

  Fly   603 NTYLNRINKMRPQFPETAIVLTTEHLKGPFFILVVGSCWAALTFIGELIIHRWRTQLVSTSEQQD 667
            .|...||.       |.|:.|:.:||...:.:|.:|...|.|.||.|:::.:....   ||..::
  Fly   541 VTSPRRIK-------EGAVPLSIQHLSWIWHLLFIGESIATLVFIVEILLQKSNQH---TSNMRE 595

  Fly   668 RRSD 671
            |.|:
  Fly   596 RSSE 599



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.