DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60a and F59E12.8

DIOPT Version :9

Sequence 1:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001364714.1 Gene:F59E12.8 / 186629 WormBaseID:WBGene00019123 Length:379 Species:Caenorhabditis elegans


Alignment Length:205 Identity:46/205 - (22%)
Similarity:71/205 - (34%) Gaps:65/205 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 TSKMIATFQD------PGY--LHQLDELTEVVAAGIPFGGHEESRDWFENDDDMWIFNGYNISPE 519
            |||..|.|.:      |.|  |.||::...|.:..||..|.    .|:.         ...||.:
 Worm   197 TSKCNAIFSEILSKHPPEYGDLMQLNDREFVSSRKIPLVGF----GWYP---------AQRISSK 248

  Fly   520 FIPQSKNLEAVKWGQRCILSNRMYTMQSPLADVIYAFPNNVFSSPVQMIMKAGFPFLFEMNSIIR 584
            |         ..|.|....|:.......|:.             |...|::..||:|.|:|.:| 
 Worm   249 F---------SIWTQELFHSDIWLIRDFPVC-------------PAAYIVRPTFPYLDELNEMI- 290

  Fly   585 LMRDVGIFQKIDADFRYNNTYLNRINKMRPQFPETAIV-------LTTEHLKGPFFILVVGSCWA 642
             ::.:..|.:||             |...|.:||..:.       .:...|...|.|.::|:..:
 Worm   291 -IKVLPAFSRID-------------NHYTPAYPELTLTGKPSKSSFSLNQLSSIFLIHLLGAFVS 341

  Fly   643 ALTFIGELII 652
            .|..|.||:|
 Worm   342 TLFLIAELVI 351



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.