DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60a and Grin2d

DIOPT Version :9

Sequence 1:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster
Sequence 2:XP_036008580.1 Gene:Grin2d / 14814 MGIID:95823 Length:1345 Species:Mus musculus


Alignment Length:256 Identity:45/256 - (17%)
Similarity:83/256 - (32%) Gaps:75/256 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 APFVEADCILGLEMRILGFMKNRLKF--DVNQTCSLESRGEMDGPANWTGLLGKVQNNECDFVFG 341
            ||..|..|..|..:.||..:.:.:.|  |:....:.:...::||.  |.|::|:|.....|...|
Mouse   484 APRPEKRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGV--WNGMIGEVFYQRADMAIG 546

  Fly   342 GYYPDNEVADHFWGSDTYLQD-------------------AHTWYIKMADRRP----AWQAL--- 380
            ....:.|.::....|..:::.                   |..|.:......|    .|..:   
Mouse   547 SLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLAFAWLMPPMSPEPYSPAVWVMMFVM 611

  Fly   381 --------VGIFEAYTWIGFILILIIS--------------WLFWFTLVMILPEPKYYQQLSLTA 423
                    |.|||..:.:|:...|...              ||.|                    
Mouse   612 CLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLW-------------------- 656

  Fly   424 INALAVTISIAVQERPICETTRLFFMALTLYGLNVVATYTSKMIATFQDPGYLHQLDELTE 484
              ||....|:.| |.|...|:::..:....:.:..:|:||:.:.|......|:..:..|::
Mouse   657 --ALVFNNSVPV-ENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSD 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir60aNP_611901.1 None
Grin2dXP_036008580.1 Periplasmic_Binding_Protein_type1 <156..415 CDD:415822
PBP2_iGluR_NMDA_Nr2 432..849 CDD:270436 45/256 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.