DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CATSPER4 and cacna1ha

DIOPT Version :9

Sequence 1:NP_937770.1 Gene:CATSPER4 / 378807 HGNCID:23220 Length:472 Species:Homo sapiens
Sequence 2:XP_021330381.1 Gene:cacna1ha / 560875 ZFINID:ZDB-GENE-130103-1 Length:2198 Species:Danio rerio


Alignment Length:306 Identity:76/306 - (24%)
Similarity:135/306 - (44%) Gaps:69/306 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    72 DAWDMQEFITH----MYIKQLLRHPAFQLLLALLLVINAITIALRTNSYLDQKHYELFSTIDDIV 132
            :.|.:..|..|    |..::|:.|..|..::.:.:.:|.|||||. ..::.|.. .||..:.:.|
Zfish  1120 EEWSLYLFSPHNKFRMMCQKLISHKMFDYVVLVFIFLNCITIALE-RPHIQQSE-RLFLLVSNYV 1182

Human   133 LTILLCE------VLLGWLNGFWIFWKDGWNILNFIIVFILLLRFFINEINIPSINYT------- 184
            .|::...      |.||:.:|...:.|..||:|:.::||:.|:...:      |:.:|       
Zfish  1183 FTVIFVAEMTVKVVALGFYSGNQSYLKSTWNVLDGVLVFVSLIDILV------SLAWTGNRIFGI 1241

Human   185 LRALRLVHVCMAVEPLAR------IIRVILQSVPDMANIMVLILFFMLVFSVFGVTLF-GAFV-- 240
            ||.|||:.....:..::|      ::..::.|:..:.||:::...|.:||.:.||.|| |.|.  
Zfish  1242 LRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFFHC 1306

Human   241 ------------------------PKHFQNIQVALYTLFICITQDGWVDI-YS-------DFQTE 273
                                    ..:|.|:..||.:||:...:||||:| |.       |.|.|
Zfish  1307 EGGDTRNITNKSDCLQANLKWIRRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPE 1371

Human   274 KREYAMEIGGAIYFTIFITIGAFIGINLFVIVVTTNLEQMMKAGEQ 319
            :......:   :||..|:.|.:|..:|:||.||..|..:..:..|:
Zfish  1372 RNHNPWML---LYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEE 1414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CATSPER4NP_937770.1 Ion_trans 91..313 CDD:306908 70/275 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..438
cacna1haXP_021330381.1 Ion_trans 1..323 CDD:306908
Ion_trans 644..871 CDD:306908
Ion_trans 1143..1413 CDD:306908 70/280 (25%)
Ion_trans 1464..1695 CDD:306908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.