DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CATSPER4 and para

DIOPT Version :9

Sequence 1:NP_937770.1 Gene:CATSPER4 / 378807 HGNCID:23220 Length:472 Species:Homo sapiens
Sequence 2:NP_001259619.1 Gene:para / 32619 FlyBaseID:FBgn0285944 Length:2145 Species:Drosophila melanogaster


Alignment Length:278 Identity:70/278 - (25%)
Similarity:131/278 - (47%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    87 QLLRHPAFQLLLALLLVINAITIALRTNSYLDQKH--YELFSTIDDIVLTILLCEVLLGWLN-GF 148
            ||:.:..|:..:..:::::::.:||. :.:|.|:.  .::...:|.|...|...|:|:.||. ||
  Fly  1296 QLIENKYFETAVITMILMSSLALALE-DVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGF 1359

Human   149 WIFWKDGWNILNFIIVFILLLRFFINEINIPSIN-----YTLRALRLVHVCMAVEPLARIIRVIL 208
            .:::.:.|..|:|:||.:.|:.|..:.:....|.     .||||||.:.....::.:..::..::
  Fly  1360 KVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALV 1424

Human   209 QSVPDMANIMVLILFFMLVFSVFGVTLFGA----------------FVPK--------------- 242
            |::|.:.|::::.|.|.|:|::.||.||..                .:|.               
  Fly  1425 QAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSA 1489

Human   243 -HFQNIQVALYTLFICITQDGWVDIYSDFQTEKREYAME------IGGAIYFTIFITIGAFIGIN 300
             :|.::..|...||...|..||:.|.:| ..:.||...:      |...:||..||..|:|..:|
  Fly  1490 MNFDHVGNAYLCLFQVATFKGWIQIMND-AIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLN 1553

Human   301 LFVIVVTTNL-EQMMKAG 317
            ||:.|:..|. ||..|||
  Fly  1554 LFIGVIIDNFNEQKKKAG 1571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CATSPER4NP_937770.1 Ion_trans 91..313 CDD:306908 64/268 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..438
paraNP_001259619.1 Ion_trans 165..436 CDD:278921
Na_trans_cytopl 515..648 CDD:288761
Ion_trans 835..1028 CDD:278921
Na_trans_assoc 1054..1296 CDD:284034 70/278 (25%)
Ion_trans 1318..1571 CDD:278921 65/254 (26%)
Na_channel_gate 1561..1613 CDD:240441 6/11 (55%)
Ion_trans 1636..1871 CDD:278921
GPHH 1880..1930 CDD:293510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.