DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CATSPER4 and cacna1g

DIOPT Version :9

Sequence 1:NP_937770.1 Gene:CATSPER4 / 378807 HGNCID:23220 Length:472 Species:Homo sapiens
Sequence 2:XP_031750725.1 Gene:cacna1g / 100497283 XenbaseID:XB-GENE-993391 Length:2361 Species:Xenopus tropicalis


Alignment Length:375 Identity:80/375 - (21%)
Similarity:153/375 - (40%) Gaps:84/375 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    26 EDRMGFGGAVAALRGRPSPLQSTIHESYGRP------EEQVLINRQE-----ITNKADAWDMQEF 79
            :.|....|......|:.||:...:|....:.      ::.|.::|.|     |.:...||..:..
 Frog  1140 QSRHSLPGEYQDCNGKTSPVFPPLHVEESKVDYSNNIDDDVNMSRGERLKAWIISHLPAWCKERE 1204

Human    80 ITHMYI-----------KQLLRHPAFQLLLALLLVINAITIALRTNSYLDQKHYELFSTIDDIVL 133
            ...:|:           .:::.|..|..::.:::.:|.||||:............:|.|:.:.:.
 Frog  1205 TWSLYLFPPYSKFRLMCNKIITHRMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIF 1269

Human   134 T-ILLCE-----VLLGWLNGFWIFWKDGWNILNFIIVFILLLRFFINEIN--------IPSINYT 184
            | |.|.|     |.:.:..|...:.:..||:|:.::|.|.::...::.::        :..:...
 Frog  1270 TLIFLAEMTVKVVAMNFCFGGKAYLRSSWNVLDGMLVLISVIDILVSMVSDSGTKILGMLRVLRL 1334

Human   185 LRALRLVHVCMAVEPLARIIRVILQSVPDMANIMVLILFFMLVFSVFGVTLF-GAFV-------- 240
            ||.||.:.|....:.|..::..::.|:..:.||:|:...|.::|.:.||.|| |.|.        
 Frog  1335 LRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFYYCQGEDTR 1399

Human   241 ---------------PKH---FQNIQVALYTLFICITQDGWVDIYSDFQTEKREYAMEIGGA--- 284
                           .:|   |.|:..||.:||:..::||||||..|        .::..|.   
 Frog  1400 NITNKSDCLENKYKWARHKYNFDNLGQALMSLFVLASKDGWVDIMYD--------GLDAVGVDQQ 1456

Human   285 ----------IYFTIFITIGAFIGINLFVIVVTTNLEQMMKAGEQGQQQR 324
                      :||..|:.|.||..:|:||.||..|..:..:..|:.:.:|
 Frog  1457 PVMNYNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEAKR 1506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CATSPER4NP_937770.1 Ion_trans 91..313 CDD:306908 65/275 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..438
cacna1gXP_031750725.1 Ion_trans 52..375 CDD:395416
Ion_trans 703..932 CDD:395416
Ion_trans 1227..1499 CDD:395416 65/279 (23%)
Ion_trans 1568..1809 CDD:395416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.