DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CATSPER4 and scn3a

DIOPT Version :9

Sequence 1:NP_937770.1 Gene:CATSPER4 / 378807 HGNCID:23220 Length:472 Species:Homo sapiens
Sequence 2:XP_012826714.1 Gene:scn3a / 100125099 XenbaseID:XB-GENE-5812330 Length:2019 Species:Xenopus tropicalis


Alignment Length:296 Identity:71/296 - (23%)
Similarity:134/296 - (45%) Gaps:63/296 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    74 WDMQE--FITHMYIKQLLRHPAFQLLLALLLVINAITIALRTNSYLDQ-KHYELFSTIDDIVLT- 134
            |::::  |:       ::.|..|:..:..::::::..:|.. :.|::| |..::.....|.|.| 
 Frog  1209 WNLRKTCFL-------IVEHNWFETFIIFMILMSSGALAFE-DIYIEQRKTIKIILEYADKVFTY 1265

Human   135 ILLCEVLLGWL-NGFWIFWKDGWNILNFIIVFILLLRFFINEIN------IPSINYTLRALRLVH 192
            |.:.|:||.|: .||..::.:.|..|:|:||.:.|:....|.:.      |.|:. ||||||.:.
 Frog  1266 IFILEMLLKWVAYGFQKYFTNAWCWLDFLIVDVSLVSLIANALGYSELGAIKSLR-TLRALRPLR 1329

Human   193 VCMAVEPLARIIRVILQSVPDMANIMVLILFFMLVFSVFGVTLF-GAF----------------- 239
            .....|.:..::..::.::|.:.|::::.|.|.|:||:.||.:| |.:                 
 Frog  1330 ALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNMFSGKYGYCVNYTDDVVFDYTIV 1394

Human   240 --------------------VPKHFQNIQVALYTLFICITQDGWVDI-YSDFQTEKRE----YAM 279
                                |..:|.|:......|....|..||::| |:...:.|:|    |..
 Frog  1395 NNRSQCMDLISENKTARWKNVKVNFDNVGFGYLALLQVATFKGWMEIMYAAVDSRKQEEQPKYED 1459

Human   280 EIGGAIYFTIFITIGAFIGINLFVIVVTTNLEQMMK 315
            .:...:||.|||..|:|..:|||:.|:..|..|..|
 Frog  1460 NLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKK 1495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CATSPER4NP_937770.1 Ion_trans 91..313 CDD:306908 67/273 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..438
scn3aXP_012826714.1 Ion_trans 151..430 CDD:278921
Na_trans_cytopl 512..627 CDD:288761
Ion_trans 786..982 CDD:278921
Na_trans_assoc 1008..1216 CDD:284034 1/6 (17%)
Ion_trans 1239..1496 CDD:278921 67/259 (26%)
Na_channel_gate 1488..1540 CDD:240441 3/8 (38%)
Ion_trans 1562..1800 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.