DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNS2 and RPL37A

DIOPT Version :10

Sequence 1:NP_065748.1 Gene:KCNS2 / 3788 HGNCID:6301 Length:477 Species:Homo sapiens
Sequence 2:NP_013286.1 Gene:RPL37A / 850882 SGDID:S000004175 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:61 Identity:12/61 - (19%)
Similarity:19/61 - (31%) Gaps:15/61 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    89 KLHVMAELCVFSFSQEIEYWGINEFFID--SCCSYSYHGRKVEPEQEKWDEQSDQESTTSS 147
            |.|.:...|           |...|.:.  :|.|..|...|.  ....|..::.:..||.:
Yeast    14 KSHTLCNRC-----------GRRSFHVQKKTCSSCGYPAAKT--RSYNWGAKAKRRHTTGT 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNS2NP_065748.1 BTB_POZ_KCNS2 18..124 CDD:349734 7/36 (19%)
Ion_trans 186..421 CDD:459842
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 374..379
RPL37ANP_013286.1 PTZ00073 1..85 CDD:240257 12/61 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.