DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNS2 and Shawl

DIOPT Version :9

Sequence 1:NP_065748.1 Gene:KCNS2 / 3788 HGNCID:6301 Length:477 Species:Homo sapiens
Sequence 2:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster


Alignment Length:529 Identity:153/529 - (28%)
Similarity:231/529 - (43%) Gaps:155/529 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    16 DGEIRI--NVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELF 78
            |||.||  ||.|.:......||.:.|.|||.||         .|...:||.|..|::|||:|.:|
  Fly     2 DGENRIILNVSGIRYETYKATLKKIPATRLSRL---------TEALANYDPVLNEYFFDRHPGVF 57

Human    79 PYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCC--SYSYHG---------RKVEPEQ 132
            ..:|::|.|||||...::|...|.:|:|:||::...::.||  :||.|.         .|::.|.
  Fly    58 TQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLDIEN 122

Human   133 EKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRR---QLWLALDNPGYSVLSRVFSILSI 194
            ||..|  :|.:....|:|.|:        :|: |..::|   ::|...|.|..|..:::.:.:|:
  Fly   123 EKPTE--EQIARLFGFEEALS--------NGE-LNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSV 176

Human   195 LVVMGSIITMCLNSLPDFQI-----------PDSQGNP-GEDPRFE------------------- 228
            ..:..|:|:.||.:.|.|::           |.:.|.| |.||..|                   
  Fly   177 FFIFVSVISFCLKTHPGFRVDLPSGAHDAHGPGAGGPPHGHDPMGEPPQTHQYHQHSITPPSGSI 241

Human   229 -----------------------------------------------------IVEHFG------ 234
                                                                 |:.|.|      
  Fly   242 GPTFRVTNYTSYSSGNFTASGQATPIATIKGGQRQRLKRNINGSILNEFIEEKILGHNGRRKHGW 306

Human   235 ------------------IAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVV 281
                              ..||..|::.|..|:|:..:|.|:.:|:||..:.:.|| |.|:..:.
  Fly   307 IETYGQPHEAFFYVELVCNVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFY-TDVMQRMG 370

Human   282 ESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVV 346
            |.|..|       :...::||.|:.||.|||.|||.|..|.|.|.||:.||:.:|.:||..|:.:
  Fly   371 EYTGLL-------EAFSIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASL 428

Human   347 AYTIEK-EEN--EGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITL 408
            ||..|| ::|  ....:||...|||.|:|||||||||.|.|..|....:.|.|||:|.:.||:.:
  Fly   429 AYYAEKLQDNPDNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPV 493

Human   409 IFNKFSHFY 417
            |.:.||.||
  Fly   494 IVSNFSMFY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNS2NP_065748.1 BTB_2 19..118 CDD:308049 36/100 (36%)
Ion_trans 186..421 CDD:306908 93/343 (27%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 374..379 4/4 (100%)
ShawlNP_001097131.2 BTB 7..99 CDD:197585 36/100 (36%)
BTB_2 7..97 CDD:280393 35/98 (36%)
Ion_trans 307..506 CDD:278921 76/204 (37%)
Ion_trans_2 <449..499 CDD:285168 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D818306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.