DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11406 and mag

DIOPT Version :9

Sequence 1:NP_001014548.1 Gene:CG11406 / 37877 FlyBaseID:FBgn0034990 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster


Alignment Length:375 Identity:134/375 - (35%)
Similarity:193/375 - (51%) Gaps:51/375 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QVHRIETADGYRLSLHRIP-----APQNRWCPQQLRPFLLMHGLLGSAGDFVSGGRGRSLALELH 95
            :.|.:.|.|||.|:|.|||     ..||...|    |.||.|||..::..::|.|...|||..|.
  Fly    44 ETHEVTTQDGYVLTLFRIPYSHKLKNQNEKRP----PILLQHGLFSNSDCWLSSGPDNSLAYLLA 104

  Fly    96 ARCFDVWLANARGTTHSRGHRTLQTSDARFWRFSWHEIGIYDLPAIVDYVLARTNRRQLHYVGHS 160
            ...:||||.||||..:||.:..:..:..:||.|.|||||..|:||::||:||.|...|:||.|||
  Fly   105 DAGYDVWLGNARGNIYSRNNIIISLNSHKFWHFDWHEIGTIDIPAMIDYILADTGFDQIHYAGHS 169

  Fly   161 QGTTVLLVLLSQRPEYNARFANAALLAPVAFLQHLSSPPLRLLASDSSMATLLLNKLGL------ 219
            |||||.||:||:||||||...:..||||.||.:|.:|              .:.|.||.      
  Fly   170 QGTTVYLVMLSERPEYNALIKSGHLLAPCAFFEHGTS--------------FIFNALGPLVGTPG 220

  Fly   220 ---------HELLPASALTQVGGQFFCTASRPTYALCTLFTSVYVGFSD---YPLDRSILPRILE 272
                     .||:|.:.|........|..|.      |:..:.::.|::   ...:.|.:..::|
  Fly   221 GIWNQLLVDTELIPNNNLVNRLVDNSCHLSN------TICNNAFIMFANGGYVNANASSMSVLIE 279

  Fly   273 TTPAGISRGQLQHFGQLINSGKFQQYDYRSPRLNTLRYGRTTPPSYQLANVRLQLQIFHGSRDTL 337
            |.|||.|..|..|:.||..|.||:|||:.:.:.|.| ||:..||.|.|:.:.....::..:.|.|
  Fly   280 THPAGSSSNQGIHYLQLWKSLKFRQYDWGTKKNNEL-YGQDLPPDYDLSKIVAPTHLYSSTNDAL 343

  Fly   338 SSLADVQRLVRELRNSVTQMYQVP--GYNHIDFLFASSAPQVVFQRIIQQ 385
            ....||..||....: :|:.|:||  .:||:||:.|.:..::|...||::
  Fly   344 CGPEDVNTLVENFPH-LTEDYRVPVQSFNHLDFIIAKNMKELVNDPIIER 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11406NP_001014548.1 Abhydro_lipase 28..85 CDD:282003 20/53 (38%)
Abhydrolase_1 67..371 CDD:278959 117/323 (36%)
Abhydrolase_5 67..>203 CDD:289465 67/135 (50%)
Abhydrolase_5 <315..365 CDD:289465 14/51 (27%)
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003 20/53 (38%)
MhpC 56..366 CDD:223669 119/335 (36%)
Abhydrolase_5 76..>197 CDD:289465 61/120 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439412
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.